%PDF-1.3 % 2 0 obj << /Length 3232 /Filter /FlateDecode >> stream HW[Gvl'r&p H8Ҷ~yE!x@K&OK&S}:uٶAW]S^`(t5crJ ᛼A? R ^)^~~+?h?SxfgDr{ww||P*.AeV7GRuejϫw?^{ONnN_}qM,GB>a:*tN7~ǿ N.~~ ~hZ|>'gra64bzG I:붚)sx7OzY:Y*W }|u,v>3[v/g=i:GR-߾I` fj1좐E!«WB,aĔ2”lBq9 Q7e͙@nٗe dVՙ,OX:W-ّ倌쀮'%~rKL̐j S?m=klU9m'ݐ26 ~^*X-XعS` + y!S{Y´۱ۮX45J"i3~C'mWx #YLuqVI}IhW1 ..U l%qV! J"X##gy^qu%nNGHk4͓ėoᎉ/ l$~J9oub-Q~U||*A{Z/^n[\) %6&r nH@Jy0s}fOw3382m#1 $3F0Jΰ 1Hg @eךm(BV^d]7ݎP{φ:1l%CM >v$]Ivkp>4g+c 33%@I1b()R$mSh#fθon nxJ$"n2-Ma0;Ӝ5Qu}(1-sVA/IDL-ՍrI\Duo @e+1 ڎʭ CrXV, ﵟH20?Wyl6=֦E,FF$+߂QR}#y0"tvj(̩è̦sgp\0ھc8F%iG Ndtcsg)u1<#'xw*b1 3tG H:a|-$Y"5踣n[O }$& 0oؒxii2"le-;b+J:R1;MK-%b9J[-IЉZU]۬Hg\'{ T\'%\LGRm]қ֡goJ  `B@hOɸ1TCY0ԾUyEpgAC ',XկXG}$*U?>Ow`׈#%zU ]irсYl;$bcT`x |L ׫>rV1ȇ)8eӈWE65DSa_L\ھrŝ KFiI}|lh?Qta!K`E VKض)QkEXklw`9]$Z@aWVbo#asKvABM&*A GkT]kQr}|auॹI)5nhZJٸɂ,(uɈe%Emot/ :@ىXv3J0n(P@qtJ AK<;'400olLe%Q2:˽PI6Q0`ltBi2,x2cDc4cW[Lp`cVb7(˵k%8&1;i 츯;_2kϷ*q3=-!5HH/ E [Gf5vt('w8cp,,>,c:]wD:8C>Nlsp [EK<;B ^\7 a-K޻2npoi-;4GQY3k?g .ϖ `5r4ۆyE"~ldK{rye2DE'IKLh{jI ֣~XOf-WRNF)BR'ZB-[o«%w< F0N7*L6{+gé0,(/W __D`\M]dzMaFC&3:<JH&l w'|VCy|suy̡ _u])Og+V_'Jɣ&<3fB{Shd 3a2rk)"EPMhTpӐ}8l*ɎgsOˑJԶg|MObl8xnn;ό}ubVFMlۭW3`wdwgɞRWX endstream endobj 3 0 obj << /ProcSet [/PDF /Text /ImageC /ImageI] /Font << /F3 4 0 R /F4 5 0 R >> /XObject << /Im1 6 0 R /Im2 7 0 R /Im3 8 0 R /Im4 9 0 R /Im5 10 0 R /Im6 11 0 R >> /ExtGState << /GS1 12 0 R >> /ColorSpace << /Cs8 13 0 R /Cs9 14 0 R /Cs10 15 0 R /Cs11 16 0 R /Cs12 17 0 R /Cs13 18 0 R >> >> endobj 13 0 obj [/Indexed /DeviceRGB 255 20 0 R] endobj 20 0 obj << /Length 783 /Filter /FlateDecode >> stream H---+++)))***'''(((,,,...000333444555111666&&&   PPP^^^ZZZ;;;>>>HHH==="""!!! JJJFFFBBB888NNNCCC@@@bbbjjjpppxxx{{{|||qqqnnn[[[gggؓ222DDDTTTRRRWWW򜜜AAA???IIIEEEٗ<<<:::777%%% ___///GGGkkkUUUSSS󅅅⚚~~~ccclllQQQ}}}fff999VVVKKK\\\aaa$$$OOOsss޻зwwwrrrŸLLLMMMhhh```oooddd###uuuƬYYYttteee㾾Ĉ犊ݖiii]]] ՂmmmXXXyyyzzzᶶvvv ~ endstream endobj 14 0 obj [/Indexed /DeviceRGB 254 21 0 R] endobj 21 0 obj << /Length 780 /Filter /FlateDecode >> stream H """$$$%%%&&&)))---///111222777:::<<>>'''!!!###(((+++;;;===DDD888444666...000999BBBMMMNNNQQQRRRXXXoooeee```aaa333***IIIZZZ\\\CCCFFFHHH]]]@@@,,,555TTT~~~ KKKUUU  ñ샃꟟∈،ݧ˒㥥ͼߡޠίٴҹȽ ;~ endstream endobj 15 0 obj [/Indexed /DeviceRGB 255 22 0 R] endobj 22 0 obj << /Length 783 /Filter /FlateDecode >> stream HǿȷcccZZZRRRBBBJJJ999CCCsssֻmmm!!!""")))&&&GGGqqqQQQ\\\]]]~~~VVVnnnYYY(((***777PPPiii{{{fffLLLNNN```wwwɕrrr000 888???'''HHHaaajjj㫫111@@@XXXkkkAAAIII :::DDDڠeee222///333;;;UUU^^^[[[KKK###xxxҺSSS+++lll ttt$$$ddd|||}}}zzz yyyTTToooFFFvvvbbb...OOO<<>>EEE===%%%666MMMhhh }~ endstream endobj 16 0 obj [/Indexed /DeviceRGB 234 23 0 R] endobj 23 0 obj << /Length 720 /Filter /FlateDecode >> stream H>yyyooouuummmqqqssskkkrrrllltttvvvwwwhhhgggiiieee```aaa\\\TTTUUU^^^]]]VVVNNNMMMPPPLLLGGG???AAA@@@EEEFFFDDDKKKQQQRRR222"""((()))&&&''',,,///000777888<<<;;;:::444$$$>>>CCC===111***!!!999###...|||~~~fffxxxcccWWWdddSSSHHHZZZYYY[[[BBB+++%%%666---OOO555}}}zzz{{{___bbbjjjJJJ333XXXIIIpppnnnij¹̼ά 忿 _By endstream endobj 17 0 obj [/Indexed /DeviceRGB 255 24 0 R] endobj 24 0 obj << /Length 783 /Filter /FlateDecode >> stream Hû̱¿UUULLLbbb{{{|||}}}˺ǹSSSHHHqqqiiirrrppp⯯صڶ񮮮^^^TTT󢢢VVVkkkddduuuxxx靝eee[[[ҘXXXmmmꠠ]]]tttzzzOOOPPPlll~~~jjjwwwFFFZZZvvvsss\\\MMMyyyNNNQQQaaannncccDDD```ooogggKKKYYY???WWW===IIIRRR___CCCAAAhhhGGGJJJ777999111***<<>>222333///###... ))) 555'''((($$$---444+++ !!!,,,000"""&&&   V~ endstream endobj 18 0 obj [/Indexed /DeviceRGB 255 25 0 R] endobj 25 0 obj << /Length 783 /Filter /FlateDecode >> stream H666555444333222111,,,+++((()))***'''---&&&;;;<<<888000...uuu{{{ppptttqqqwwwmmm|||MMM>>>oookkkJJJRRR^^^[[[gggZZZ999YYYddd\\\OOOUUU齽fffEEE///%%%$$$###"""???aaazzzvvvyyyVVVWWWNNNAAAhhh~~~iiieeesssGGG!!! nnn===DDDBBB@@@PPP```}}}jjj:::SSS–xxxLLL___XXXQQQFFF]]]lllbbbcccHHHIIICCC̾KKK777TTTrrr   ~ endstream endobj 27 0 obj << /Length 654 /Filter /FlateDecode >> stream Htߒ0Ɵw8W:," ]wk;ՎEE(B$A#-{0rN~|4AI'n1&c5Fb?e#+\ :ZƆgGȍIxy7L'_fjHj 5V˧lg wI_qIܷAZУH<X h v+5+fCCNXJQv-mPZHZ@p]KFuR6 $hIj֦T{ б("T7= ]\+d{BkZh)8+lTT#RVBb|oBȲQG G+ih%QZ*9q=p{4rϻiY΂k*yoiK"K ˮR ".7w0 qƯr˨d}.8/ *pě9E;NH9#kdr0/vVi L_gAGȢYԸcﯣZ<JR> /ExtGState << /GS1 12 0 R >> >> endobj 31 0 obj << /Length 2883 /Filter /FlateDecode >> stream HtWۖ۸mI|J=x+ }'9ŽHpy֮?HB Yx0v#y)̛bJ'׃hC- 3 2LYYDfVYd(5J6 }yNqr's:?G,ma|[=5#Z{+Ñ^Q^}!-¦NJۍp麤, @[:oOg&zΩaɱҝVl,/D+kxrSr{+/.;_He_+Y!!9ɍ2 u,%5φ Nqi:jXj#ŨjJ~G|_TNQ{h/cP<Ge_p a9(:"rB# JT$ ؿGC7ȟCcȓ$F+{[>,]?np +՞S#y@•0Tએݎoo"IryYa,K6E  %|8mQ6JKqi?CeܵP_!^2&t-m1K> rI@N:7'&aciu:^4:l4.[IqKreh=.p)וRbOM$:5.Nr'9؋Ay6HkM{G8U?lm)Y1_5i9,M>;jvL a,TC!5 6k= 3̇~%N-9`ףPRt]~ 5 ރ6M3[Ȏ>+j4/<5 #[W=ѭ> 3U į^'g~γ핰tiǍ? +}q`5St.  *Cjt8y-(xEdA!芀 kas2JGhq]@\{F>&K_&8qp1V%b Ua^[:Ӏwrv2>2<ڛ(B`qх56Wt$JM4H%.GO07@eԏ4Gk[OrFk zJNi\XmaSGYލj+efc_H:un ϾZmgd%Ia&-*Po:rv:2p`:;L;s}Gsб O2ɩk\S|'3-jBj}?lu]hg"^֫2W*#!Oycr[Q(];|J]Prkkdu8.;lI~fFmϬES{ZG8 ( > FnDaTHEHu_ݾ Ÿ*E{zl:>{5/[V.|v;fOiڠu)hGn|"6;u? : p@qji'9@6DD HTb.8rD'͌7QĶ̛)&t[E/4*xI;ewO=™흉U\M2OpƎ8~w5,r2xay)Y.0`h)&Mv^LrSm|#LG9:4m2/3iFAw}$_p20 `ӛ=qUgH~t |#<Ô7mǨRzl@Yz17 ;3?4S䤕ŵKE& XgwgsGmFkę X+qg{jGc~XA"r˼P?bUkϝyd{hşJm endstream endobj 32 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 34 0 obj << /Length 2064 /Filter /FlateDecode >> stream HWn#;3@[]h;ML`;GV\d_֖ؒb D<<<,Ͼ_,?)xID(!pH[q洿;~pa[93l<𢐄C%OSaqb%0Q5_E!A (иk[ʘ[7ruE#a%xhOA{IJ^|G&DPiwIpDaB;$qpƩL1f0(W=Ә(LH4g]%cyAL4CqAUUȺ`*<!`V4L>Q\a}'k,i\4ޙ09D68nB8 Ȧ۽QɭTLeQb̚ !O k~Alusqa+~baLZ$wT\ODܺT| c%do47!偭-wOg`{ͤrY„(&-%N AĨv^%"&,a!=U4i75 \|bj \uw)I`iBU>OkmqP$MK{/ ! 84 qjx+3oJ QDPB樗1/ %sV%JYOXLkdDu\n ϿE;V|A"K^R@N:²̤chTQ+_M޿ 3=:䷜5Sڛ&a%p:xVsИKD;þb\`ܒ 8~?wۮ}+-ww(݃TU#$q٢+4vsuTԉuۧ=R&W(ԩ0pq1BwhWNjmuh~5鳂;^aEW ҟSXlYN'ckoXW{y3||cߥ@k^LW&lj-MNlu(и jJ!JQ%굞 _=7!.mu̘&eMjWAWT|cdק؛ufmv? ?׌U. Y~h ?ڝpZ!w+<ԂM(h/KOnoϔ ]|"\H^n4xI0\뢸aȳzB^nIݑg蠠EF -$8lZB_R1eiW3LG jBWh+&_ iYs ^OH c\tpF_riwsX*  IQ7?ڽũ|T͍| vϑFtYTj@7, ,Q$ICgRlpMgYbIh$2/Sō&@5 wK#g ủ)UnY]ɧ:_!q{b# 4mk#fK=Fٷ #*AfNЍ6G!{]RVy!w\7ʥvZ/EJ3U//ILMS/^T3TtɖyVENz.iь֊agr3C %|Pdm\a /r+pt_hnϔߌf.!]D I|*ZfXGLO7 H+VImnFk*qp&|.g`` endstream endobj 35 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 39 0 obj << /Length 3938 /Filter /FlateDecode >> stream HW[r۸]̭CRH~aLj`"mM[qFO<\|JP/ ¿ 0$AI"8_Fh7kŇ_] e`g)z]A92'Rъ>}rG'"=yH/x5jgeARd0ʁ36w_G.s4^KB9枬'Qp/JZpE`R(E,6`A4XJa`gnnG$[XY0A)fQHN1ZV" ap+dUJZ&`IL v fz%1W0$ (QfuUڨ&Nxd@X 321%bd8'3(/[zoA4BݒtCӵ8kC0hy r$Q慺/RFHߨ?lϬЃa8F^)kx4\9X&҇,wFna;VWh\ruKgY6HDzO.4U;Xn<9i)Dr4#|G(6ǒ 2Wnw#<AwW{A(cXٸ&s,M94T4:"Ahò<}{uI2*F~yzvz&Ƃ6խ h'"ʎ2Ige4)YI҉)j pfzZ\y6$}8m #@֥Q-1Px&?>= U; ӤŚջ~df Viia#p vB&NJV^tlxdBTQ ]\3t dB#g$=`;_P% V w`\3w}ԌH /f0aYz|Xr%$hio5;@J9o &jl6[r49IAmG6cpitO~~DIE:4Z=YIv3LT@xV?+,un 3)Kr܍o1m*$`8cI&C_&6( 1l"ŋ?e5\Ir?,$G{ދK/Ȩĝ,0>&gT* w+TRң=*#>H,a @V9IWcgoD`)jom#G:edΔ=߽4r)Y|\=uvB`- j& N#hZ (~iW>./3)fzEiPC'/ @k +["h2pDNϸ@7:8{uhO%b&}gv( Hi"y+*l3'6 Ji+ި6/"7D 4;̂40*"dQP事O^Noxs;i6(򫯖nYvN$/LR<>:Ѡ|o= R(\K۹?^G8WϤίτsnf.^9[x03Oc9p浄n0Ŝ9Nb^*J[iVz5Sf{C`. A[xM~=O!0sXXR?*W/݆ꊑI Z>zc%ނLjE9Q -ץNgiғ`C齡P}gp2>@Վu<wN nc~:Bׄ*0KVB8РojCh <" pF*_Eо 9;\Ihhs3Ua^?WЧO6uLK;t ٠)L(+_Zn=F!y|dq=jM[_p p0؏@\0UN$&ۃ|)J?|Y3 D*UUff^&FY0f%ՕQdߺ3_?e?WVw?XC!/iфZ/X^ Jh"y7>u3 W-d}DBH{-,Qc4'猇X`dMNIPm5-1lw[cS @5OJ~V,x5hM!̰*.y䥂=-yD!aØ찐aYq/H|4jߩ 7$-Un-*l'(p!uE4-L?g#%S3߉:wb, 2LFHU#L}R bHlb 'DSiAz0i_eXxEd1=‚ k),* :im[kLYLv4if[7Pǡi*zj&FgT/䨙 ę!ۖV@}rMcѻ=aYVW4HJ[o!0 +6Gkz$zEx[a.KK+AY'dݞQkEL{w[XnnsR>{}ey6$*jð%ҕJOrߊ2ӷ^g|}nHQw$ę l43#TQeZ;2sS z閰X\Ym^j8&rGg }(P& I6]r a4W A0$#*beKWl8 Ṯ"D߳!TҺv'"*xlua?1*0371衴7'ʈp endstream endobj 40 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 42 0 obj << /Length 2200 /Filter /FlateDecode >> stream HWr8UQ؎$9,", 4Gl$m dTuoOϾ| gr_4v8LP:Qo3Wٗo3J;?;q0HN&_zcQFИ AϨMI0(p"ctKDIx~ i/(Y8~&-a< EsY2:'8a-ΜK4c$aI9 `y xX<!ї o!? 2qֺiCrBܥq 0xCޚjR7A(93[7=- xIUUT? `-xx]fH09Zk6aKAvhX\l%(Zk>4XiT:V~`c@[)fg7.:H@9@l\%!<:At\QsX뢠RO̩o1> }#Gz}' лcI`rB|s렟En,Ja$D}'D%p AaYj+ ,ƀ4NDE#+(Fs?DMo|&0) ӏSko+["JN%()G3A&=EpA%[ʈʹ;xk[\ /7zKĀUza3.[Sg}L:膗m˿EeSc{xIf$(&|h vk{N9VHIÉ7{'@ J|: &iRIAUnsL ѣQ=M4i{xWTS}Nĺǐ-S5O ,SKc^Yiê靭>i0g@r܁26K&Q\`WdCqNo= &S@ Вdةc)"stȻ(Ϥ@W0h KI2 V3p,r=8? ö,52\ᒠ{RK$b{Bb\iE_ 0/s}kVƕXLL1P&6,ADJ6 W:uxA}:uč.8qme]X#["=x[I!0RX~_Ǟ='=*bA ot@]d=Ԡ#RgVmCޘGPKt&膰H=n췃s|Br} 2a-cK#YGAkBeAtT6{(5t"ExWTϳ KtԨE~NY@b0pDKM$0?G`[* Kz<sAn{\B/wN=ٱ|-aKL Hn W 6QνV!c]h‰{ǘeGmC ;xYʌY8q1qr,-HV8ȉn,+{9:u&vLҘޞ1v,J`89ȖJ}-]Z}fWC|0I+m-8.0uMٹ뮨k--e6%JHS oqʧ3{?Ǜ=֧(uj/WYg0nA/@@iYR"|$zBHLŽ&ĸ&m{_PuHIX#~PI\/)5KTvve~pu]-eD[S$xWpc`% 0nrfNGHsj/sq>x6Ϙ4Yz2{mF ZZ`veoaSaUoAjٔs"`-H\]o Gv*No}9-g+tN"דX%Qdyo.ĉC.UQb7Hأ[]5 8q)7{˞ܐ5D4XPt{,Sȶ3guW6 Q]}EsKџ@11amݏߵ ?a endstream endobj 43 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 46 0 obj << /Length 1236 /Filter /FlateDecode >> stream HWRF}3x?c 0ct2([zw$;mڦ[XwΞs룴Xg!_ jd b"-{w8ܣdAfKԋ أbhLb4hfQr렸aܪZC\ҭfeqSfw>5-a,}L??:[:ͱFǣhջoO":ʑ٫}. @!U\&I=3&+2Xk̖W{JB~AL(<Ї(")ӠŖ"f>`DحNŊv:ޅlvCD#r%'\aVZ'HO/ uKC&VbQX]k[g4X~#lXŎxj2XQPڿR#LY MYtTdQ^:5\8W嫛TidWY+_”]G>+پnw(G #{Vb۵< nx躟nٝ%"P VVMyhZY+7҈~@}0.&xrz 0͹_­q&I:^Gh0޽G!E/ ?+iA?`CnuLh#nbEwa endstream endobj 47 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 49 0 obj << /Length 1858 /Filter /FlateDecode >> stream HW[r۸]Пʔ;?D%3%XĘU f3wKg3 RrHٲۙ$e+" s?m`#K,9lٲg6ܶ6,rf:3?wBw?ZfIJ;"v2~ee$~shv`2ou!Q@ L|$2Ao0FGkDI,.MeQ7 ?XȒ@DWNRzXc1bj馒Bx>qm9(iBG&$(@}J x.Dh6uvzO7ծ&nH|kol]'|rCBaX$p9siKE!A'> r:4ly庄>8 YŐcKͣv)ZL)r!;p)> u:$8~"y8SۭHcgqՆ iqs`Ρw09>f)ױ_QާD!uH:E} %89[^sՁc.3 _$E،&VAit[=EfKdfu>2*9eڑ罀~>e=csI3#'L7EI&3ŮQ,MVO3)Q4m&OmpPD. mԽ#Z`'IJݍ^ʮْanj3%É}mbru(7b2ovAuy37^rpsJec&8ƙxKW.Y2Џ9Z%hj=p)9Df[.1OҼÊSk}#wf]YsVF>NZL̝͌,\l^d#obvw4e/a4: o׆Ӿ߯p̑FBq4fuKGkZ;QN2 ,KHw0dz #Z?x j_&kLw?[W|sP0Ժ?g\*m/l׎xFJsR2ʊU mpsr|D5>7“B!D^pOs^pYqǥPu[jJkOK⡶!oE&8a;ُUendA<8 ʅu4kO>Oq)qCS3M7de~`޲ARdIxFxR`ŏ endstream endobj 50 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 52 0 obj << /Length 1442 /Filter /FlateDecode >> stream HWV8~\=Ddrt9=QcS>>Ҏ KivY5473 `0B |7kֻ3C< N`q:#B8{ |Ƈ-J(,nwa "3J㯙"qmKv>ZG|99dOVl(Go{]G`tC:pJyѩê٭J%yAمqC|UHSGY$j0X"Ug2Q*Kw2N5&Om' <{iQe %BA/Q9SYi#a4"K\Lr?|#&+sAGwWaCٗn^qԄ"e moKKLq,"WIY݉ݩD(l}%$- Gy>0+ w9;4_K U'ZKf>2n& 6U,'IJsgROi,ZOLQLWJۣZӸ GIMJ)+$ J[ J5F8?v))HϓP˹0$pY<=5RmfI^&z}EuлWS>R>jvbc}kYzqB`2u+RiI$Rߨ̣8Og"^.rq1drqjy/*q Sϔ*Q$|cJdkC1ax|P?G|b0#תXj^вN<P:؇k~o,0=T78P&i#ЄO# ʢl& BO'=$3ֆ[aSj-50q]\AAPc5D.gçv?>@((1u7I_76wx_PGw(p}g8FmD2Cf33sg}z bA [2TIQbufIīaPokn5X_I{=8G3"yB%vo`O0XWɭGXymgy[P<6u‹ **U],TXCr奞GU}h5UZݰi6MoVb9)EAc: ^erDt|:=XSǙLN6PYV,ү8}˪1M2l_"kئp+PJ\p21e`>uHwz+FK8{wb0Xڃi|=Lh,Kto2:Mj8c#6~;^f~D?-7쌀x.k(I N=[3VncײǒzR 0bg Z_AA3 >7As|Ъ^J(j.`cl endstream endobj 53 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F9 54 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 56 0 obj << /Length 1682 /Filter /FlateDecode >> stream HWr"7Al s% vX28ݭ<`h^G?iI Y\eQ9=hat-9Jc{N`gۀĩfq.BHtMiwZPY'}' DTlķ&S"'D ƪEݪ$8`0: -iH]S*݄&uodV|{mԅMv(meBS&]_g9aC;/lNף^'ۓ6VFtEuw|i9LLVYZ y[u- #ljMZj"2N(H]&a i{gΕ~tSo6=5YDM׈m7o]]'=|!`й\9@6o1FMCsvA I,YUg'^vq 6T:NZgZ^ b䃇FnF;J,׶wbK 6pdSP)2$7cu L*'њ|!/BJ[3)Vp $yE0PƹXrebt˂edŠ(2׆4̈% XubN-AS(Ȝe~; R,)N-8,5:LɪPdQZF^d;V5+ jPçB>_ĂRgʷ #3os=r=8XRŌ tfh}DIT5=@abSZ.aB.`:fd'f) aV,gc)-r8}nwN%{'TRtK'^sA˦[9x E hQY-y+ F+ns`rC7pAja 8.VcD)'4nt kS}}le\+"ؾ!O۶JR&B 'K{/qAPld0I5)XFLO`-xc8z `ߠ >%fv[0~A(;vW> /ExtGState << /GS1 12 0 R >> >> endobj 59 0 obj << /Length 1720 /Filter /FlateDecode >> stream HWrH<-u -q(7ڇ!6=3od+4ӧtMN.(qt~!vPCVG!Wx8j=#gMzCmَO˶mG?X ՚K!='c9YJp({'ˡVʻQ"ˉ9%'ٜ\"9s"hFss$PLǝo{brY|&O?D~=szh;ڶQv\9ET9qeE[WYϞ\h`& mRjnw~S"#Yd N>B<%9Kg^1{b~@:Tx?3^ΐd~q嵬a_Gٯ =-ܮ١=˷p?-2̓|OڊwMԩb%עm93`I ?"ӊD,x*s&[;^ZCENN%M\Qqanq諸vp%E~KHd??I 9EMp_U">%ǵ9]h8Q S`sI!HޘEKl`\ U!m[0He7u*z:fqG]`NUT֦lIOX$b68'IUR;:zjxD&k T ˁjfX0Ez8Mt|s6} TjNIz8"tq'"m,1rݶ0-錯9>Pi"H9vxnPZ@VyQy6E5aeI|5+s.%[~6meķ<ۣߡ"sn(9'ToAtfl~RpD9XF[ bBڭp؁4u|bqԻdM<(8NF=ϡϘ+RQWCVmSIv_z u^nj yVArڥOXnZ!*m\{9Ml]C(^NfkYVVVk>{XTg*+s2\cbOjuĊEqY K J#KN"y昌 K/̲v(*(^ZSdY/~T".S&c$)T_R 4XݓO$-.<7Z+\49]|F3/F*[RC]AS1 37ѳhZ5U9[pݜ)5]GL+]Ư.v jɽr> /ExtGState << /GS1 12 0 R >> >> endobj 64 0 obj << /Length 1666 /Filter /FlateDecode >> stream HWr6>u莄/ES;VZJ2L` P u.@J&ڎ3,{Ξ]^@ao ^/I\>~\ޫ73 ?/M]/=\Bs=}4 CI #oy)J f(`^u('AD6ruɄ,w}UzE.9~Jj!7&i&&庁 30q&w~T[g\\laUH [*.r7kD$s#| '4|!,t(߷|Q\LJsRZX9VxCNB6,=zyxA4wn,+șmĕ@:6\Q5fBe/6R,TJVv7bʥ70%(@}jQޱkR@;qVUM1h-OV >  (UXO"`;xa4 X DȥV 8EJ+#-r OJ !q5ua[ H]$16ip$%lx6 #͊jw\zt|_G#%é}<fgE<[m`B@U äZȿ:ܻtyд6eY9EOC~qaG y~Vlu8h@ӀЗó~|A&AEh@^FZIt hŷ[ f\HHlsQ㖎QX v^)7\<˙ø?.KI툪ͅ[eɮ2~ Y#)S2b옕 eB NQ=4v4f6R7%38>\*P 5L"uRD%TU_a^> P 8<?h$~0>5f2^L&)u} t*0 Rg)%P .mG(p 2e:f-6ƨonq=` /TpR6p8F_+zGUvEBnbD4:ݻ.Zk?.J;poa;cW40 dʊs ^Ekvm4 5[_Ŝ[(ul]Ne%,pVOV)là[:զL=Bscloĥ-X~E騬ʯɼMx/@QAr]—]X(C $-5%h{JAެۋ endstream endobj 65 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F9 54 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 67 0 obj << /Length 1573 /Filter /FlateDecode >> stream HW[RF]П&-0  4'H3Ό#KHU֐5'=32@X{ӭio8^ .xC'z)+{]odB7Lyc;z^ IAEv1 a#LRL}a8g\'q}Mz3#U%b|?p$wD]Pb}y>ҍCa p!E*S? tm[{~h\VNh~nvb2$8J GFCaK/_?H:-'aPM׉2 Z/Z‰ > /ExtGState << /GS1 12 0 R >> >> endobj 70 0 obj << /Length 1485 /Filter /FlateDecode >> stream HWv8AFgbi2%hgAhb$ƲI#ـK;%ks>5."h4nDȂ١bȵ9lְ3^W7C& ~k/ލnjeEvLJsz=kvpr\:n5̤j4nH0m\fo8N,щb@ :OuGѫmCնm &~,FAXٲ$m~Pj~ֆ4=ˊJ\5U*z(𵊼n*g2ל\U,(=ftP?3ޣ! by+UTc9 1Rx B s)5׺PrSB!(n`v(gs D\)]pU'r))M37,k.,)`_s3:T)M/HF:uM(S,&"QlaS%\c`xCmݖ땗̎n3&bӭ{o/#L7oO;ti./oQ`Tr\rp0ٱr˒gp1']>WS0tsX !R3٫#K53mѽ<xm6vy@y9@ʌg.8t؛+l6;\Fg>g4UE\ =#o՗S?6=r ]ծa5qe]N'B\c,M8/[sӔ/TtA+Z10gߏlKoEɤ57pcˁz4bTv\oQ&6X@<8x-[|VBrʖ avҔ&}aZl5뜠~-`Y {q笍:8Ok?r3 @oF [Si$} n`^P!GJ#|z7j'9+p endstream endobj 71 0 obj << /ProcSet [/PDF /Text ] /Font << /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 74 0 obj << /Length 1704 /Filter /FlateDecode >> stream HWrH}$[Бɟ) Jͤ mP,$Jvgڭy9- #xwW s=ly" I.m"`/po1{&uޞ&3\Y,7oUqas<צŸ7anW*%h8cLfjEr*SE[7LJC,5cEb{#G坢wI>J01 2*xI@< fYVuJ,(:O}fQ^qB< Ł8S2YBFwN.Ga(:&1R'%qVlw:li(*:my2Jn2?,͒4< G^>(]ˢR.#ʸGc|I!N6 Pni$s"GS _TUuĠۇYcsʙne}-.Z*zݣO`fz1f U 2^Tk2&I\urJj*7z]8S1ˍ,"ثUF%A)ӜiO]YA|2ɶ]fz<;g>N8̽k2q@UTӨ fܯR-)!Z@TA M!^0iQr6L!/F[]BEj[sFZFZAR˼A yjǫˤ#Y[ШuR*WCVNeLtSfk̵MYA/hb腵;v},cvU:+2؛"Jzeupt91o߫twǢ~<@ѣK5(]fJpmRq]tَ0 7}/x)^1^[3afMEug İsP4F?ɋ<-?6;I0OU^u5?p.lYvCW325h'O9Aa>&YKyۮ@`NE{8Y(XEZ_ص =صG)*7JcԿd0jU%XJXݫ(فWpyJ}jp]݋dk 8nٟq:'&<$+vc|7j:JB ٶ8m^%ќsr˳s}#YIw> l1~ԫl2IkxgMٶ1m?F'Wg澁c-:'l NutX6ؖٲ&dS>zPO θ$na@\nxq6xt3@cYjMNf$Z"5ũc0J6Jtv1zaY<~yIN~;P7,ha(G Ў4.r{SٓC>PzƎf2نxah> /ExtGState << /GS1 12 0 R >> >> endobj 77 0 obj << /Length 1636 /Filter /FlateDecode >> stream HWrHC?-8^CnXbI8?E`cf׮2.i>}ΙClF䆾9v@m"vΡǃ}F bc* #RXjm  N}mye ,;lxvdq}z|ѹ4K{~̶lM z7t,'j-m_۵\?c^ vm' f11cN}ԛQ_ BI:}xqtdV'15=kX߳\BhV=v]oW]Uc&4h h.JWL:Z<+ɨW)\g"ʳ(h>6&rEQOi^ˇ'LVO> F7;ݰQRHfr#@eHr!Mo~ZN,^p]R/>i!$|Δqk:N9 ws?瓄]TdowAqf uzB͢íuPjJ[tA'JV{}߭cﵘ^܀\ѭ-I)22Ɣ\ߛgZph7[P~i*Q`ެ52S&{ =gta ,=غ߭Ɛftjg8sײA-ȯRcR>D񅞚~GL[dB"}# dV_Ddl/\۰Kˠʷ*MwYAW1xGB5q\ bm8hlg!GtN\Xs숨C'`0bi.fAvz >}}VYb|b+Ce$]aalxv _nYDeN3teNCǤ M*guk>TTT^N,:Gт6uh9JnYЭOqo&HV,q"AZysruFsAEkWtp:L endstream endobj 78 0 obj << /ProcSet [/PDF /Text ] /Font << /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 81 0 obj << /Length 1733 /Filter /FlateDecode >> stream HWR|A?3[c HfHX-l9 ־϶l$0YĶ>>}P2]oL\[Gٖ=J>^N(Y2?OG/k!>L8S6l+,%^Bu2Զ"ۡ7=o XYpgrNe˜& Q 2PYB ^O)Y 2D'8z3׳fؖͭt{95 ɇ~nISdg)Lg(MT?0XXO?>E}\p6fǵ#9g">^DIE'V7#J "WGyt uLN`J]+ݭdϝ 04> GA+|{{zv ð:PaSEcVcSƾ߳~O{S%qɣElw5bN:jJ:m5b l;:$G\4Xyᡔ !bB8% 6Y1IR,3F+]u$ m5MTƊ@mU Lb)qi-Sܲk9,\@]JKYL^OB',eG 9+!s3鴔ZADm7V_~~M}םӰNևQ7 :m5\QR,PlZl-PF( X=k5&ܵ&lQY@-;rr)tsaƗ WezLq}Po5%˟X&-L=ߤuWjet8m7Vtb"jE.8yִFk `S7o`x^gkEsgzs+E*g d!H T7֯,.}=p01~?rn̹jF]whl^0'ժ?&SRO{PԲHކuR7WcZfͫ QM|'+^6Jea޵4oI џ䈢w8A=\3FJ~UN~,iʽNIa=`?pcA^lQ2Q39F|zL ܼ6zM8yͥq0Ra9n@}Lj*ׁbol3T) ݁pg4ʢ ܻ0d |$"B&U40أ_kuqWbfUuee aPw S h;PVEKyO,ZO tB*1.,is> /ExtGState << /GS1 12 0 R >> >> endobj 84 0 obj << /Length 1696 /Filter /FlateDecode >> stream HWRFC?jSF+o\Bla,,Z^?d#^U5>ُ( |J|:` ~gnC ߉bn`|R> h O\˴c&PvIx0Q˕(e)o\!E!U:e6yQFlw1pt00Q%>Z HK|ˢ9$dz$P[cpyv8_}N1&b&~ޗĶ6yiDW'1U&!쫢TͰOy!{}~D-byXňIJj 9E\̈́3Be1n\Jl!ヶP F w7i9Muy bFL *q^-_fNBZl}G.S1ۈv) zZı֬0܂׳~gQDY`ay#u-cE*2=)u2pO@ߌT^4 32VQ) ;O*Fٴ2gG;`DbX/c>ӓ!xaKq. xȇuϦbJdG'V;P%ؕ(VRS٢>i3Lu ~ 'MK7QGY  s۪h5Oa6a6FÕ9),{}c-tƑi#q8 '6Su%zBDjD6틄Jז2 TxTu)Q׸q"R772ԁl.Vd%qR&r(?Z$j?%o!m4z3x`~b [gե}j΄axrqvQt+LVdIJjqZ@tm8| ;4 p%b?NJ_k}QƩDuC8Dž8kוN矽5ua|-Ѹp endstream endobj 85 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 87 0 obj << /Length 1469 /Filter /FlateDecode >> stream HV[RF]{?){ L(G#7VRe@}%$c }s̏ޞ4?EAb"<ˏY@糀'Qf P7{(ӠͧG~X>O9R4ZiљfKR>jQ$N7,+JVKb1u/,+YahI{Lpmݺ;ߩ W.1MT-vо F2n/ƙH8]{4ީ`7k@na`ž_ՠjfRpCJӸ Li0cQe`Y¿859&&g)E "*U%\2S]ztzR] )Q9٪S&hѹȪ0Uy23̱4]QkaErey)riSJ**{ì0bH]߱Lf)U*;)ufɅ¼hOC z>D=nڱ!|mF3d6P װB'lީս)O;eZEc qe 8vޥL7AϏ:7Z[LaXMdWwe%GVSā8.FЋ; P\O2-Ty#pW}@ջ1~T\[Bj9(UZWj2\ l Y{RvL Q&\]Ϗ`o^n{n&\\LjU$(;0E[$5,9ݤ٩ %BbkV{^?#m 'žE^?sQ;<=Loif֍ h,ǟ 89¿j/o20/O'$sb|PrU\r׃^eHԦ̣":̡A5\<ԛ{|i$m,Xؽ3';hl_;|/qkcu3ۢftU[yR#ްO_Ao&}N7>m\m%,Od|{ o_ KE#Xy|f~4R\c+kthQ0;KVq+sS[wx},4WtAen DjHBl ܂L%3&rsc+mS|l{zˍp:jeUǨRrΑݙj/wVs>s`;ƺE*e~Qi76X./,'M”kҫr0 ɷhf{8Z ?ΔᝮQfcK_6 :w,|&ޖ7Aܔ yP 8j*N7Fϭٷl+f`19^)@>дmT~:U:̢05ˍ{ۺ$e9p'NG 0? endstream endobj 88 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 90 0 obj << /Length 1595 /Filter /FlateDecode >> stream HWr9Ad(s%5$vJeS ψAX͇lK3`v׮—t>}6Ei'E|KB >!j=EWdAӪbR"F9Q(yr颡E(`.5Ѷ I<~v3^ }N#~t#.U1Br2N;gpbdAwΪ|i@_))|qJjFFC=[t9scR>YdӅ|Zw7|KQ% e)53)'K1)5_B ]-8D1"Z ;9RX/.>N8j߯-@D̋,7Z /5ka~RbhhTS9-5 W9x/Q Z*]ᰋ "5dhnan %ĵʤRXITh)!jˀr i]rte'Z(/c9|&$jO{l¬#[N(#ȋ6ՠ}5G|H"Уwpik`<6j\讓`@ 6&7ߠox3AId's+{n ?K]LVF=kq+t_R//պivZ+$"S P wȜBAdU RhsK"Zk8w igd~7'l9.FL>Q0qYxv-0 4(Q;-hypxx.Lq;7 $Qa= i;P|j6!r_0؛Z,魛w"yޑl\b5/"sÎaasN8}C,Szy n]V&Qt==.D An<.(+(U1@\4wwSu> /ExtGState << /GS1 12 0 R >> >> endobj 93 0 obj << /Length 1834 /Filter /FlateDecode >> stream HWra?pҨu0>_ 8qMMCc]=ߕ_K'[>q2 k)ch|IoB E||ӗYOS]G d7(8 h<88^kw<t\fQ-e.WHi(2^K|6 qlk?~~_tĎDit{px]$[ˏb8 3};a,ҚO2qD8N'8pWgB-jUfGt^UK}+QotiR隡6t_MPJp5Xis#nxΥ::B  ˇy?j,ۀ 2ۏCFvD'dm|:<~9MdH,6eqs{U8I*RI!G)_rQbJ׳# cp9s{UDEWաpM$컱Ow幑 CÓu+4V17z?8^G9p`a~R8dvf\fxy~n{2:v> >L{v1-j;aк {uD;A{-TH52F}1Xޣ?WU2Z=j 9zP9׷bH+PUk Ur:yWP̲(Ь45a(Vy6MaW &U}D>ۏgr6΋Z&q/K,<6sp$Q? }&o[-3Y6hX> };0nJ]~;plI8lŻvb"SNgM]@,?gr3iZNw^j}T.5X;8jCƒSb㣋bY{{;{XwRAzxZVnAt4ޠmF^;JÕ`+x"3 D[1wY1Do:Ε,7=ɹL'ұZUyᲞiK`-%+, ժQ"RYG]OC5Rv*b^B{`'4z֣\Y?ݔ o˳vtG]Z{7<_Pz3=m+{`چ>k.>-':ЍV"w8sĨ+.+ѿ.~'D ~͡HRAXB/ yd3ؑF_35 endstream endobj 94 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 97 0 obj << /Length 2206 /Filter /FlateDecode >> stream HWRH}ޡ/גr3e Rݩh w{Z<ľ\l$I?99s!ObboLȳlϏo[A6p˧Cf9~3Nǣ'?UTqwvnd|vd[m;8yW1a*/p1#})r_|3  0 F?[ږy9.XR%#=|_2r) +Hrc\<)|zJ,cK* }\q,;\q,׶qqZ}ENRaaΨJR'[?폩Xa͒6NJЩ;vi\L=8؂'&Qr1uʋN*yjs'"mlg\YPg ΈeΐʌRȹr\š܍ݺăuq?1-M#[W&WB>fl2c,iVҍt)ed+Eq%g?VՄ궤Tf \I1g@ط(6Joڥ%"r(`ǺRѐ޳<5(쁢'r1>KѰ.rFz#VRr:,/۫r&YN.t *^ #+!ZChn|TsgfZ0wȶ+AQ׵`̋nY)~PrIOHOg)(`*T~9H F/߁Bg _fEhF1!jc-~T5Ho 3#dD(%4Ak>^-&VWUrRYPVQCAӔ68}|1=?i/ 1d5_^uӎ(Kl` s -ag%ЇK{Ŕ'(9-W7 /7,k4GVjrl|S5Fɂ;-w[*ݐݱ$d`8'Z^ R ҙ\C:KKAT777܋A/P╍b˶B7>|o}%4~J?HB%8E/.L-<Gg _ЌRt],N8l&UV{9a>8h_dNzb,ћb9;]`0 kGrL*q R$\?ć@L_nE-K NH !Arbw'[NYﰸ9Dh7 ^؝Sji Y䀕!ΨR8h^,En5Ш1 L/:̥Afxe#>S&TӋZ?xZ#Ls@|JD*ڹ rnV7tڹI4kt7xV>1& 6y|v0kV} ʻ nuloZW-߯7q [P? gySd\w"MIA-:Yy)k:—rڶ;iptSF=KˀC CM2eL*>o/XȵcM2Wu8nG ۊ~8*Ds.ռLP+s:F\m׃ϡ©$~a?y^k~FpATMTu2__>3%f"yc]40Y'),.͊3d@c)QZ#?r0pIJiHӐ-9{4KmŰ}ʣs02%Uls\mU4ZtGLk&)lEӈ#PP;9P)~P( o'Ξ"瘁xwذԭY3||'"U(L1c#c| N!ejf`xۯ0`g(`.pTq,8{>DɟcV9 sm²VyqT0(Y1{GMs'O4=\f '4!šyk7ߙ*3kso÷o xO$uf/PWd(z~j+d |bR4WJW1"@f~{`| endstream endobj 98 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 100 0 obj << /Length 1568 /Filter /FlateDecode >> stream HWr6> !H𖗎dKlXLDAԀm#m}h Pڙ5#=EG)P&  |`QFL-\7b·ƫ!i~{l4'W啦ZM|jy:\}Cd'-Y6q=fJO\ġП/(ɗ#fAM2q*3e,VNLP[>)z~%Q$&!uER0 u~}HT4ְQG>753ϟO%O  HI0W) ~ylHoL؞d3.ˎ:>kh544,Rg,SrN4E܅gzI皨> /ExtGState << /GS1 12 0 R >> >> endobj 103 0 obj << /Length 1725 /Filter /FlateDecode >> stream HWNIC=:+ܙ1@0 lEyhanvgO 6 :uQiIVH~Cc07l23[O&f?Snq>.sߦqc00l}9~9Cfly^H١,gW䪥OXlتc2 KU1mg3FUU9j:j𯍤(~NEqhTɪKy{ [U.3i8Qj6lY9s9MN8t'Ajv᯹0T%{ֵ͌<am_{g t 0vekL۴7P{y5a ?i g 7_ u]hV/ 똞ޱ}~t[Rl{Y6VAmzV(i^̼zHi$fBLhb*7||qH4—>5tt!dp tG~g2wjU5Yڴjl[=Vg_32UTzC1նTd<Ї e4疲;Ӕ*W9EV,̴` >QAz ' GjyEMygi #L$(8^g2Rk>]J4spAq" nj:?8O[I\D_x6Dn7-3> :e7lՀOyAKd?3pÄ`ᮁ[o1G>Oqo pN$I<ԥ2MEB<ԟd`3~'\FkL+Bm+D A3@/Qms%Zn9#cSl5[+Y8Ӌ*եxsdF"C_>&Ea!:jms @N:°Rk/jnXM+DTu3ZMTF] }ә]Z/jrx{#cOPF?/41d{= xv/<򩄽J9ɕ0F^qX۳]: m`VcFR1;2|Lۈy=xXZ5u5g &z#pjZ%H#2Tp:"w<&€qZ P1!%0]w2;{ 7&-bj)IϜlXo[h [ 0# endstream endobj 104 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 106 0 obj << /Length 1563 /Filter /FlateDecode >> stream HWR8~ղlO'KI-1e! 9#;Pfjg|IKh0ֹ}罰Rv7F]E܀Y*Q|<Sfx'̿NǏ]V,->E]xeK"<2]s\E|˦.ܯӅ}l>0LU W8z@2s)~)\tr82YhQ(-LGciym%A`%BhVi|w1:SK<)1#iW2֬VPlBἫczCWJ> 2Ne)WG!NeU"-|I`?rZd UεL _Ԙ2wYv_fѢh%> ;I_!~U! Ofaw !<"63w/ǃ ZCC7g=d\BUpFRR:f6Sn37Wcg Lq';܄3_?A b e*\{Yry^a;Hd$@dI<~6])M M_|g2R{}^v݁GmCABf}by6&È'c6LIg ϝ{&GvUy 7d*ZYHy4.8#ru6QGDpe 9O5}U1`mRg ek(Qy$l`4^'4ΉDB#<_w}$R2yðgDOsve}-z6ݿ,z>"׷Fw(4eK\#ũ>NN6JU61KxQAkӾS -_P@nୢL_̜E}t2 v^X!>ct<2ʋW'@AxУIlz<@F@Dbܵ-!Į74y:gKH˾LPR+(w$ 㺍 Nڞ endstream endobj 107 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 109 0 obj << /Length 1649 /Filter /FlateDecode >> stream HWR8}~,$?;BKi(C2;!%VlCWr옄P:;@kWW{wtN)hv-ӍVb2eh4籶Qn$AD vnR&з˾9:"+z,6/v:GF锅JJ"?ń9|`EXX*y`\/ y" w't_u0C1D#0Ս|/[,s%;-a@]Ю?ҩ10ߞIpE= 5'twb7v6]|jL<蔄{τ2 CڬZ߷3ҢzB=/YWo{8ppr Z?]'yՈ<9NalqpyjE )X)~z lg]<쐀vbj`]UMHGWyCZ^+ Q(VK># \Yzctd *{Tm5dzHf1>WY{\qkv^l .;c;KM*A> /ExtGState << /GS1 12 0 R >> >> endobj 112 0 obj << /Length 1442 /Filter /FlateDecode >> stream HWr8~\P%amIJ`nQ@l9)H{d1,NBnz1`0kE@7=cpz!f,lu):Ս~9p(daJHf%]ntJ i< CY$ZJiebjAmCtǃ.#Neeتy~z+r9PLyg%D^- H-5Gp)T!Ɋl#$\rGwNC0JEbrdbc^s~TřjX]}U>/%*4dt߷ݺ9&W)fY/T2K5i*vjGe(#QՔfT oSq[Z }06AlPxQcUqy6`~n4\AԤEu˩ix|s A1k.1zR$#:;UfV{\]O "jZ$]Q [t? 1 ;.LU C-+T+-odAfH=HL(\~"j#4 &:{,J՘vЕUHOw\=6<92Î,,# ۰)pVqڿO+FqCi{:]B &. 0cֶ{t:\sQ,zLj2''k~WN7d]{ۯ4e#a*wi.D.τE9QkiT% _Eh/O^[_DV~;%v5Pr XgblwK Z\%;̫Jx7/0&Vms9wE _#,JnZ=.-H_|Lyu|xNXÕg3r^W5vv rQKS$+Ka^^O̅QvkIb=ROjSX m@?yno[Ì]ܬ`sJū,{jU`eץvBegen&qFQs=3 _*pCe;rs/ST;{Z&.8f˯lkK ݡࡀk.'7;[ ݭ57F[qWؙt&;EeJGyw!Q/\ֿ {p-x endstream endobj 113 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 115 0 obj << /Length 1601 /Filter /FlateDecode >> stream HWR9͖}Ƽlm'6E& £0\o϶4c.N* U`QGǾ>owK(!H ls|p2a?xk=>s,:AL8K MH!ָy{`zRjƔ_MWS_݀H&"H9>˹ =#:/Ccb `0ey l~0z&/#V{.U}{t,$aIy38#. s g.La\ ~nrw}УJ\PY8otƄ`0LhSB ty^6v#K1ADYM FV>.xb:|mB}Ams JdNpXRB;+(^}Op&rfbx~׆!՚EAsO6TY1 !K9]GVF ;C)R})KTΐ :epgGB[3zwN?iuԌ݂li$  mWwk+VU/Kك(#IiF,Nlw鑐Fs,(mY,IVY6Cm ҈d+y&G+ Z'xC0-|m ~'(V1iξW5t6BЭ1mWM8e?"m%Fɲp٢?`%>jYNqH,N!CTZ)mb;=u3uy)5n@u%" ]D?rh\Sq4r˺ zQc;6强kJ9o SuD/K4>>';#T5RfaeL-sخgej>;Lag ;"0'^Au ~96 G 9KY:('urJ[q?30i ; $ɼ Xi~AkH1z;'@(4!p> /ExtGState << /GS1 12 0 R >> >> endobj 118 0 obj << /Length 1491 /Filter /FlateDecode >> stream HWr9ɖQFsʼnJm<Fay%m>tg[ncpTj*㲥VsԽa%@a8nt4$aP=us8kxW K*^? 4bmt!$GІhᯞ1`Srp,NmLƫi{>p黝7l* - OF+Fp& )yr r *S*Oaq⫬c{_ͳ O?[1t'n |j xJ 3Z5087 nx!10֎.2;:-Wxm6{L=230:EϬ̥]aA+ e? ;X8 Ibj]_%ԋ Z_r-Ҁ^f[|1!)>$@psӽ~ɉ8 Ox=]|lѸC&/W0$~DۋqE۳k DHt{]fkCM[X-cK Њ,ab GY Ra\<5.%`{\̕^˓端n5vs]6cF{I]?)TY>\@//'D[i CYǭs&BCxFФSwJܳIV> V{X.6<'js(Fi/{Rl5d 6{nS#̩'A^mU-O3#˘1,͘wm^^j2+(fD+((93fXtK3FGGpuK@wUtu,5'uxHmZ9r[1 49z5{"iLƶP6 Sug1;bc> /ExtGState << /GS1 12 0 R >> >> endobj 121 0 obj << /Length 1470 /Filter /FlateDecode >> stream HWrF~\uH674! EL&ŊYI^֛OϮpbgڙ3~{wCzeE+ءC\JU Zf?v}58aӵ}Bׅ'~x0nu)f?”Lpsq/clⲨ !QеMq( !9IYlSKLG\Ibi<3T6n,# \ Y1>|6Rn2߽ tmR0-ǒ!lsd(X TΙJSb(xR< y݆cy&; ![oYhMOBٞZ(^ܐ6BMȷX-'!LR %WL@h{GRft9:zefj ( id I,PWij f|H:wLe7{yMF=oёfw f7HlcQzW\s7‡fw;|J?Esdl]< l4ys—E\w!'vuP:Ko+׃5YSat=0Qiߏ4ENSvEQ>n&`KojL;u%s˹rn]݉Z UXI5ہK\ O!AA^:) Oʒ&Em_nѐ xܛ~lJ# c.E_I!%v _b_3\b eU7V;!#PQ7&}1my:8 P8N]cI`ɡ εjO `0Z6WJ|)2㠆L V|,tU‘9LE\Ә^&.9_CĆ8U^ǥ]^ғ0ܮz~Г,"xC90-STH깑X_rT)IOwfn.> /ExtGState << /GS1 12 0 R >> >> endobj 124 0 obj << /Length 1742 /Filter /FlateDecode >> stream HWr6N/Ď{$e6XL!H;W.H&%˷&X,O{sN8.z3 w;z|N=VÄ+o3z3QBaq5FΔDjd V 7=\OԋHHik\NF2 ZETBDK\uw=B 95s,+줣^WO 1T ,L` EJ^@.j>R,ȣ)%bY>d0)21GL-sCumL#I7؎_mrE&fĘ5y%ᄌDđ 8^'Rf엃?*$AG!ص½#o똼۴l;q!@jbPM(2Y0!\: c!S8^ٲÁnլ@Ac~§H|W,;<>KKr>#OZJW>xpP=hi[i,joTVgnMIngtT*XVle"SO{řFYSѴ~ ؍c;##'kCb;> x˞蕝書7OZxP/6"IҼ^Fݤx^s#|`3W$W~VZ#ɧ Ń\Y<7;Dujqs9DX}đԉkۻ@E"x^7³&.Flg kzg<+kӴZIb\3(F:8Ĵt7 endstream endobj 125 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 128 0 obj << /Length 1586 /Filter /FlateDecode >> stream HWr8V-$K*d>##Q|dn0;ST%Vӧi_kn<<j N+vhNlYs3O# ϺV~~fb se:$9Q aܭ뺞 g:bI%dZA~T{!jw4{,2Vrw^`nodɫFNP`-90}ȴVB3ˏ2c`ȔXix>u|wŽ';T\FN`ia 8c{ևN}oVVprloUFZIp1:juS{oDgi/AUV _ɣ غ5RYϓFN "&{p53z :gnF(|JW & f8cGG) и@r]"y0r?|#syϤ A@L-Gэjf<$+֭ȮVc)5Sǒ黮x1 vrj]QsdP NLaއ%Ol bEҬnxEA8G((}xw}1T4)"+f8/ D#jܠ2bV4c"w1o`&3suN@aQfbf5J>,px&J71HIRLTᔛѺ4>$>ްs$; ^rTL4e TilMgk1l'#tM$r:煗מ-2.ލXKCOGL9LgWȀPI9H&R~`ȼ=# 7&'I?> /ExtGState << /GS1 12 0 R >> >> endobj 131 0 obj << /Length 1402 /Filter /FlateDecode >> stream HWNJ}LȲo Ih8 UědP};k狤*]E3gΜgѤ\H1x}C`ZFc[QGХ2߫@U$/F. BhHDQHhs:6QBp=A_J)$cDXE,jijh~djm̸'ZOu1"I\hrɉҹnx.y<+Lt*}] ?-FJ=b\V'Sat\|Pe)%QY&ssu[EufxU u&NEpGF9 YLE,FOTYil,K ws~uR_g\dR Lf,Uav5S< ?&: xݕژRPE*<üj25}:7 Dז-ꬍgyZTx40bCTOK$lqmUsz)syf(4'uX^Ḝ0rT 7`'xƴeaƈ¼G:TucS'۸ہvK08VxEBukr={TKZxhmy54S2`!MFۘ"} ?lJLXm[vVS:[+v^ƘGfO㉷JF٣:ߡy<k@8%8*(QG7n;M$@W?K+І D,vK;dNVs6Mb>A**'nluض^FA˺zA,t:*̢J*j}_^5YiiQ~+'wH33_>pir_4+tv p!&-19?P^DpipZk!ĭ(r∄4:à9of4 ֭;F-3fvnHXxe/ov~'ݠu ,ǖy#g#鰱P6ܰ jg|];Ѯϛ/d&Rh/DȥǢ` 8|.pnTmyՒ9 NQ_5>BeԎD9|y!}3A^ "b\Nƭw~wX!NcdbT9=nO> /ExtGState << /GS1 12 0 R >> >> endobj 134 0 obj << /Length 1697 /Filter /FlateDecode >> stream HW[r6]OcK$ӑe;njyH&!hЎ.ĞH\{9瓣+G>L2D?CA Gčh~tf죙'~<>'kE)$@IH0ȭ ! b 7wt3gȮq&.?Q?“{6e&)T1 Zq1kDDq(} Ky@7L{>ѻ@#*6A@JsBrF.ulM>! 4 @+͵UW{_0a7I엽c/$!{{@#GY~.>v Nű}9.#G+OЯr.K薚[T}Z,,K pDβ~dr:eq^1jj tlRCaҪv;MiAEN*3^e8:\#5L>5h̀@v;*y>ʜz;(zC( M~h*>rsTj%[ Y, ʰ2{B#yQFAjA8Aw&N*|_ qkW|D\KM,X.዆̇Jjm. 7  c}K֖k<,ĝ|$8 -wRFt_@jJXvIwL[ΈW3^f]MA_ߝ$i;BFCok*;)1t ,=!pQѷ^94 ^+UhAAU] 'q{>ZHE%n1gn0f P©,]# Ay^];d$8 öhe3h@&i$}rW,@SHe6h'`gyI&I h+I@[i@|aVX袾4żar:EI 9u7pMMִ+nA49ok@Ѹsejn-0~VtS~dN@y,i1.=n$/Ig7)(]$Z+_{A;MgYoޤv1ok,|xT?!WcxP 5:@ʼkmj\l2.r|F׏~tYQ5Tƌ:[~R*|QbBTf@X?ۚEk fs3^9.'G 0 endstream endobj 135 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 137 0 obj << /Length 1441 /Filter /FlateDecode >> stream HWrFRlh5 6.LTVY`"fi127IKA&ڋБqـq-B h=e,x6{Edܦ5~B"(aEJF2'8dqq5;aB:~5}xs%_Jetsy{#>^nZZjC]?ayTBqýsgxQ"B2A"X>OqVb+w9LC9O/̻>͐adDzDC,iƳ>hϭ@hemm8jϔQ5@ !mdk(,įam45 "BBB,Y^2Ӭ )ɜ":3Ρ* :t',ؒB&Aut8i|ECؑJDs +D&2¬f!XJRxnB42 !0}:7=q4i[R5AHb5˩A!_QKVYZ 4l빆,p&Ӥ>uںM>ݷ[1̘mЛ{i'mh2yQs?FcX.=X WfæG\YW QrMl?5JB?Ȣwj9bK\DXL% ϋ;tMPϐ12G<1q6`9`@˂A01dT yEy_jV}iNmS/sJ&se17Q&xeiɘ<)-EnCa"U/a;{ b2\7o u5jbAYWVK蛸R|(B;fϴHv}3f sZeoiB|q粃K.EBO"Y NzzmQ {ag!(v ^eD d(eWLכLU9c%hv$uw*bͪqѥn,s?]sWzw$p#5# '|Y5 fE4`T|̃@\W]e,˩z+nDG`IyUbǾ"I}ԀE>i_yPFrߛ`M endstream endobj 138 0 obj << /ProcSet [/PDF /Text ] /Font << /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 140 0 obj << /Length 1331 /Filter /FlateDecode >> stream HVr8 |K42NML$ѥ\r?iAʎ$mw;'88 sNN]\N (!1e w.;'g d3tQv[3 ~LBFD% |PJ]XZA5_ *Xmr=q9/JFc9d@clh"^I ~I*4I} W\Q7xK(85Uy. sG߲ ,F1$ff#%Mf[ \ >&*GRU0ucq]jSZON&pL`|p): Y.^ /bVWpغYz.DYf|-L /&ܱm^Sq }?FbQ  `;$aaG[]?>3r)^h˛!%2ҚnJddtrp:opILW^|I(.#>k `,1B-+C ӫQ!г/ƿj1G.>3(w,1! ~mhB2_as _\Ҩa=X;Vc53U?'Cj)P07(Y+6y0  fZ Q?"p/ֹ!RO Aךh*Ewd#?A l𥳐5=<Y`5n򼋹.dn˼S)J+fRsC jJŵE=qwt7|GLks\*-#K#[-J[4B!_OkkNݐs65awj"g7Q1Ld0 ϒVc(IAk5>_H9=8sǰKhgx8'AalyH˻j<^`r ɰN.puo^+o1k'G1\h#\(}C`&{5o׭֨Rq|=zeǙqAüB_. vaB p>CgxG>+|Fa0?.p'.U~ďLӜfGIsRӜ&1Y᜜z ޽,roj(FċJo>ŚeE :ĭb8k#"sON2t|ݯ6^xilTrB w$S>tC%n7n8M Cc!ʶR#I-ijҐigk(IHy^ȎG[ x{eS H  endstream endobj 141 0 obj << /ProcSet [/PDF /Text /ImageC ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /XObject << /Im7 142 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 144 0 obj << /Length 1623 /Filter /FlateDecode >> stream HWYr7=a`EQlIftW>!ȁ9X\&Gp.2%[]24zy^Y(Eȧ0gMwzKGǏB;JFPH>3)7`J q (/h?V#8*! J1j.H)|" x+C᪯ǭ ]kĔ?n!רs- QxY\zzGQboKB-J0r OPbac63p|͘04hvt%NjM&[P ERDPD2%¾͝? qB0JDZqݺl^WI$A11L#o/{O7G0P4cuK"Qcy!y!N%h␦]^lu`^r&|ZIq8aC@1"$^cpH)|.8X69EȔLjwVJi(IKMg \RHέfsqu^=@_F0[JMv]@!{ђ,;]cEQYiJUY`sϙ( q-Fݓr[z`G[>Yo&JFf d46nR;V`RA̞Լ*le97| sIA+ފu=[6& ~N hVN؂h|tuX{+9onԺU!'ȸB gꟍK`KG]3u7]?Ih}/FLs(zfʺ(}"y)|5 x},l-=AzYTaBjgJ*/llC`r`\ZWJ7^]ciݿz<'Y9ʵ5Vbco+np=UesL~lV@!  W<#'7zgtC) $ԩ}>L\aBfCV;M{4.LkuQG!j1$LrI:1x45k]ʹfi,pw3jUL6ZL;&A.Pkךr9`v^)TC Bh?~vbh֍w7DtËaz=; Dܛu8MSdϫ1biӘh`+ endstream endobj 145 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 147 0 obj << /Length 1844 /Filter /FlateDecode >> stream HWr8) 7YbeU7Lj` aS$-k~fi_ARer[T(Q88t,齿mb b!ub7 EŻyϪjbYo<=== !%5O=+I },ˮ|3VGNJϊ˔Dݑs%\)5@HqrqwӲ~7:X4%#eru2KJ/f%' ^,\܊\fwA;qMr~pUTPJ"F"ČI2ͩW/Ud 54kgG(uIgLLF5D;(oT|[K`[1ӥDL,5՜k'R*UX;QRȰ8ge,Y1bL%lc%5zՄɄ~e"^D;j; ^uc&GQHjúAljaH$Rj Y*nֽهeMɮ1y2̘EVujr]ߎ,di^/|T`}$H>oa\EngHIZM7E/x{bQuҔnD~ai&ע?hd޳oޤwlܼԼ˺nDNp8^e@gl:1c_޼nS-l T2N NLJ@pB_ MK'~6wߜE{]4yµf~䊒+vSjd^J+ALsbݵ9>(r`G+|DPF&)]sY lߏ=^|TU3O`'wQf@mfvK |<M#`rٜ/~04z`oAA8ؾ=`wva;n\9.bHɅfż*#>PZ4;]>R\ LI(A{d)[OZI` ``~+f?zq-nwR";] 3k@ٲ0Y3ų:LY;7#|``)Oc6*'B*Igy4\w_Kr#vG؍ف#Đ(Qט{r\?V0p+]ff׈Z؊!94<C5[>G QZR|fx.i 8Ҏgz>. j 4-_ 9U;˻ؘT%9dd%#NYȩKht4?%9є`I54Ui&Uf;9'5_dcINpRiigXj:kՎ9e]<-_s&4c>=iD<#ΊJNBwE Kzo~6( \mSl=u5E*Ma{ݭ] @9+:<5 ("O׋ոW$M* endstream endobj 148 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 150 0 obj << /Length 1478 /Filter /FlateDecode >> stream HWr6>!x^:$X+1I>,HV>3O ulŎ3e._'Wo( u'cpC;ď]\[vlF¢$3ӽ'ɟP ! Їdرm۞W2/%W0+~JmCq}_O,$}Ǎo^Oi.20C@P@]uh u}[Z^En !9e9Li\*Dy SY)W9 X&ӐovwǬ Ipzx`9ijmXbe,9[pTrƋB 9xb)Rk \M}qb9aDKSly$]NjmcYvV/[ODn}JEXɕJ~f9>Kl yg,;Vp^ǻ(mhCd8(%qa1 azgȼ`,m5Z7P輞幬܃7J.aZVIg!Q5t\#;q|7hx>JOYk%I߇\wT6J7+;IG9ZћL;X^ȯ=:z(ŭ{6heS"7QDl9u=N._ ;BvMy|ֆ+M 9E> m0d9C,w\;"^WW.*;^[). l;)`\T|Ũ}~ڽ #2~nSKxL>=aMg.ZGJ㟀(jz|L?Ex*X?8tGqvGtQs<<هNnU3nx G۵}2\{'.z}|ЇWA0e*\S2J|[asA`"(~:]ɘ-NF7HR%E 9ּx"Cn1(o8B`An=+ރ0PCt[A_FH^ t:2 Ӽp:]Yc3D,]؊g?ƻG:(0obJ8+ XSS'zq<3&M\zSxԊZߐgb+,G#1Ij-7KkTE)+@9iYT-yq U@8~!ƵjR23y~ UsV 8NԺLiůwRUļkRAz\Zb"?g [:8-Fvz)^q.,`%z+nu.8&XF9 ky[>|y ɗ4ĺU,Oa,Q9"d[|}~Ɩr]/'©ϿL_ȷRD[d(F`X9)N=+4}t0 ? L1N endstream endobj 151 0 obj << /ProcSet [/PDF /Text ] /Font << /F6 36 0 R /F7 37 0 R /F8 44 0 R /F9 54 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 153 0 obj << /Length 1438 /Filter /FlateDecode >> stream HWRHC?-̵>8>8jl-&ڋČu ^zs5T ryY9K7$>CCS5O6bߋLREQ<ۯ #@ַ\V;JdC U, Y%c1Y<1J|JlO:q%ɒ2ʈPo78㜯fSݮz܃%U WehTHxjlܸDUd"S1叽Gpd€E$-!Pf#bPT$C0XNfOb+^h P,ۼq,E2Cq9 7'NAm:m4{6g9ppl~ x 7kjim: l:!At ˛UB='A E,Ԓ_c40XTM٫0VUd>XMSew՝j+e߶,rXeٴ~NJpPN\B^Ym%r7H 9*:2pG?oH7:#5e#nK80~غM>CQM/ @v*WrS0]2+OiRp-T)[&{p|w:V{bc>u})7Ixաy 82Ql++ʠrLڒRk#;| .;f(Q_(ygT>Bӝ)ީ9R{Y(}.EiC=*b{{b~-xR?.Iro)A'{LֵQtgXنk"hpצpCY+"7 o*dpdvMeHJRX;-t'r>l2qL1䞮5^}B+hS?h+Xsxn+x1b+؆߽0_$ƴ@cxgg9ONxm,<b ̮mرap%Jz-OGI|W . mžmH 9N2Sb$n/vă,C ~zra(w-sF9EE`?Ls$-o p(>pV &PpX=6I7I6ތb}|󞒏 񤺕[dy(ԝH. xX8q^¥uT0ؕ¨z.utߨ$|§|8#ǁ3Ձai73`< %q1 endstream endobj 154 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 156 0 obj << /Length 1817 /Filter /FlateDecode >> stream HWr}ޡRnXc8ac1BbGR=}Xke iӭIs4B }:sg3̟-g>LfM==Sg,tpi~̥JFJ4Yؘ3v lsY9eΡO70w-NZ )pBf>-[Ù_ƭIғ4ҭ̤& I|Db̋X䈉IV,ޭ61!f{'z;t!> |۵NNuYu "sINh'W@4mayg,*JZ41"F'q.[K|m¹Iu9飊ӎ{Ul8Tkl"&^3/t8u N/fnwi,zbsumwoGx0_~iw=<|y3 o=) 1"!.J=A@o2G%E%70!"n(Rf7n~%qJfZY\6%2 kIeHexE._ ;7ε,GrS7r^Y)(*D )]YfvL}LQHPlwK>ðD̸>d`8&-bls6'k-څaJ O5I֗pnL 6*E1D^? -Q\& 'vKl6"t"t{E :*8yM.t/L`j֚4\fY$LvnQk9>AxQ kb|tHEy}`]LXW h,!@+Ēc<8$QV_Dlb0ݣYb8IѢuL}t4:E#?q ns{`˟YD9^tHMz-aAB+i95ƝUiQ447rDCf$Vwְ,XCR hoݫbLYE,ɀj=0w5;\RHu"w /21@@!~mBy&Pgl5cj=\%}Ŵb 1i\QY'tA LjâyS<\InV9NB^ Q:㯔UH xE~+闘F[aIys's0i-PK endstream endobj 157 0 obj << /ProcSet [/PDF /Text ] /Font << /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 160 0 obj << /Length 1750 /Filter /FlateDecode >> stream HWr6}T:Cp_25FR&>$VNR%u<"ps=<^FV .%a넩-xFtH`Qf{lr_l)ĉ<׃w5ŏ7D0|`9 \kqhq ިwo2ɜk3eJ)ÿ0 Rz1g .UϕzI0نX7G3nv**5ڔ#/rCq0( Eޥ=.J8$cd64&!iT[ }<\Wâ։8h=wWWǪuCKxШ,/!yEp4Jt=U@ TOؖbPRZLhY[9S8?nG4zbrWz8 c:T.7>R',͎yNP6L>B_n&D}h,=?aSx+cS'Tq]'h.K-`kA;֜2N^LdLwvϧ6M=BFb 1aƛ;qHx]R`i kսt&v;;MUMS{*4ĚFqxYϛɤF%Y1rNZ l q4DWvluT&jgи==W-6 _pmNdN'i "7g:!qyGŭ knp[kZ*3CVVD_9=Oi^}}?n/jtw wl~|q,tt . w O$`C3gk^p:=LuN@b"2E󱝛g̎ oWbY%TE8칛ן"xmuQXy㌞ʷuMeo1pxZ G.Ӂ~7}ws1f ҐݣEnXW8Qy]Cg]$a<>7L7`%vhx$d(H5N? %҆  y V݉j]b ^]NQPbL;!l \nZ@$gbl]vC섉fԞ}a@I4W"j M}FgTDTduc;%)xӌ\$^s X aՎKAP=VԌJZm8L>TǮǿwy-볃̆ ;}f,>`- endstream endobj 161 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 163 0 obj << /Length 1489 /Filter /FlateDecode >> stream HVr6>:]Sǩe2<$yHHDLO?ԳuN3Db=7QD6BDePeLiaj7 ݻfhkdU~vZ}eDI nf00uG+iIih;dOȂ<ϖ8 c6wօô0$_u>}124e\IY&>x6E?^^p{ws68C'IaY>\슮'iDa=on)~#e2;NJBt/ԣ< SB0H $(4:~]#5 'S5s]j8{=dYV6l\u:X$`4$0; I2_0Z$(K{1:DQ&5*[8)B$ -=Gl[44B^mNNuG`7( 99X}ǐ@ֲUQ2ղmz7\8 yt=piG;pfl"%щ~PVpc1FgocdV ՛J"V=HdhSaXz+@գINVe\xP5<< z`j3 endstream endobj 164 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 166 0 obj << /Length 4169 /Filter /FlateDecode >> stream HWے۸<Τ44"w|Y;Ʈ-{6/<@$$CZX_뿫$\3O|T}cQ,-"H2.ן[v0m}Q7 ee:be/ {#7j47e0F?|ZV24}%{ͻd2l?݂-ʠS ۖ د嗗oھL0EPZ}reͫ}qI^zF˩+M# [Sk`1+=V88Tߋj@9J BL],OYa$o>aFF05}ͶKl{%;Eq{0INՀh?b^I sg6܉NImlPN{6FjfF,)m( Gy-1[̵& F mYy{V{47.g闠 ȫlPL[JƵ8å*U 7kjg >-n߉0nKeLrϨᘉ-,(t=<ּoh`3vFԒjUsAN?vSU M؟ԨY5j3#mU@HaicTmEbcfɟ2G1˖1t|J4(e/ fK)uߦUqE!irA1tf7>j)K4Fn%JghX{4^Si߹ i^L,A/۞kv3v+>,NC;D?P,,)0ˣJ˷A5Zs2ΤR|۶ 0T=ZaZ cU|Ug?[E9t&H[кbJA `;iF*^|k ^;JÇfp@%Xt&NiOV;tO˾j~b}į9;E;fqI+]XnN cCsVzQOݔe̶R8=7VYfA%pekFn;yCKjdy|Uv4-:7 xJLVCr4B0j7'90i9]#Ӵ4:\L@'. ;%ԲnD SqNcoqڄp:>r pmڹb_O/S_:P?Q,C=1I0d{@VV>W>(ĖbVrG,f3u[1HUi/*՛|5*LW ']{JU5kV$>q@';de?BbgZWHqY(#\ۥqKAI-{<{7-( fMY^ 8}/ɘ *@6G4aj+>=x sy8C=hFZg.jQ(M(ۙ;x,nii{+coci?Vʢx_՞"9ܬ%3aElm``O}V~;{#8 Q6ulgm ȖlqR5 GINRIN9b!_̂hϥƴ%ag뵰v;'WEdq%um!-l gu0OǺ+|)ri{vmc[`A|+ht1i`W@=cZQ)GЄrm;Z=M4Qд9 珎)QcŚ44l-AߞQ"{hS6P[NGؐw2yz 83C ^HVC̨U[D%lN<>,q;*lʾLI&=7- B\axw~7%~21B/ n$b7t!TZ[(e3X~-xWAobi^f]C^t0nZt6D_!7(WE3R5Z t۫ Z6f07) 2Dl 'n>N ΔHT 7P!F x}eSҶ֟Xkpvd}ce dXnIiߟ sr8E`K/d面8c$5U""rL*RqI%z&kI3PGHܠxDvDzX[-3<66PbVuۭҞgZP>mJ5ȋyEW6Bt|E'Ɗu8FU/#kjcdgUGY ǥ*Ì-kdj 0``o0YOm3nžݿR z8{8> 8®za-^(|c_X*>uM h'M [ǏkKڵ@rpTi]uoJ3RX! #Sp0lc Xꧽ[ǎHG@kʐ^|k՞azlZw'g헔x&y/*~o<\!/׋[%dmͣ鐼R4- =CFL0@M9&_M\fMQm;#-cGHb(!z楾o/aP^΁I3x[7|=#{<w?{!_[|bi,U;xa62FZc] gKTt+o+kK{-mu}Si(\„<< q8!H\jh|T`˦8}%0/Q $=g:D@*dα }+dY|T 2?WH ({BLE17 [T|s6[̵~/%ЊJ^&ɋ{> tE/9k']f¬}Fk٩x@ORzQdQ7F{Q-#[x^@&vn#TZ^5 v= ?@cT5;9qfy 8jA @oFj;g=6oVu*GrkYj${A4*m"x)ՀnUĨK>c!$c"k)+pMzi|`kV-ۓ-I>e$)<xzFocbdU?M'~yi+IQ> /ExtGState << /GS1 12 0 R >> >> endobj 169 0 obj << /Length 4465 /Filter /FlateDecode >> stream HWr6-ËHy$nR} I0h+iEe5$pWIbUbXVQ^SYQޤ졿b]>a{'mqWwja5(nϪ#ŏ77:9''Un5xx{ue~yV1K$*2kc#"9|{8 F+cvjLrٱ'iY`H(IП/ܦETYn(tv^k^G]χN$8qvNO{YrχesҲ⪨XQQU !X;_bhym6 ?6eQzm.`fΔ#wLS2M+G0X08*mA6jȬbuX6xdf[a;geGXA*IhLDyb}@Z2SgW̶B & ۩z2 izvVB~ooj%^rZ$h[6*RTvhi(EITTz&P)###{b+~ bi!Pt♉3ojo\fSp(/+WߔvxnΪ,\֠ ڵ+(kPc^KCAuI6BhXzw, Z6' Os(n9'A<;řTy>#߬=r#2'm; V{n9OVӾuaPu?p0o;p8.MC̬Tn}Yu mYj g *ݢ[Jl?.zeb.Z-P~gp\S~iH:Q8 GIǎޖ%xoͯ]&GzI$ _QPqo3H'd Ŷd&sk Fu75l#V4-} EqG\~Ī"wG\2C nPk[u+衳/\h.1D{|FxvYœ3 Nnh l?g\ \?'oh~R)uyaeje뽴M:TT_[FxuRz"$dgYY󚨥KsiT墑sqRe889%fDRAr ܓsjh\4p9*.Gg{-ɜ@ݑ4|_ lv$e;AA$I$O%&;OxZcjoHLSNM Moxc[j%v޼gab7\G>](~LIȀA\m6|N浲PfpC|e`wu/Y7\HCę2 HrRؚ%l^gi+' bӑӯڼ*viˣaoȫ%UGo8̼hP eQ)޿" iy/XdOp2uI ߇|n.ml@ku s?A)! Egp!ޭ!fw6mwrʮBsnUpsh"c{PSװAYLKl`YNks:|+g- %Er5{L.d\M~t;0ם!J9N_JOVA7Fu٠Y@F ^EŦ^ `ԝHD^&"lDƊl<؛3PSU'=9_9wﰁm(mXMSO>9ˋ*.p>)ڜ?+'4>Cߨ/TgԪ&CS;{= h:%Te~{7 tE%i'ς&z+t~zRh HY"atTXS|.wә`M9F/^ j#N8)kj:/4)$Š'HIK4 _ܒ%; s9pif2PeCs؄QSG&Qh>YH^l>0OWL_-_Q6O/ՊW ?-J-s_}|oaE=|g{,Gظ-Cr6$4Q^,'C6gtThE5xquݪ=F #rWѕsS3gM;LVQtpMja 3NVA@!g̉靉ulĻm# ,@򼚤:uO'f1}SmUh#lEt^u0%1@^6_yxa{4UIb8|oA( 6RZ)FK(xڮ/U詻/xD͎Œ~M\(gE[-4*EzK!+G,y~PͰgrt(qhVؘ`sfgv0k@ފZ1|uŞSM!$5 Z[ͻ!9 /$Jf[">խ^`B i8Y6 AC^0=_Z6_Tk)ݫ+]fk6 öx<0՝APQ7_ utYVcŽjE3D}^zEGP\׎PU+I j]5K $>NN)I%\3@5\G>r3*e+-c'%C0wgG[ř *&om8F/NJu('RTc19O+}qVmM@rVK*uvWIXӍCOe,cZgI7' zEA9u3:m$MݭXcx"`F pNQb;2Wr^䴄@ 6xA5`{KQ">@&xWj:ZjH%Z\ۀt1Vup#r@F ~POYp`$ު bGɃlx ^Sz,vL'Y5ˍoc"f第0L$. je~e++-%堁Ѹ3vIȥa\9g>C endstream endobj 170 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 172 0 obj << /Length 3288 /Filter /FlateDecode >> stream HWr۸}~t:ΌS?f7٦κu@$$"&/wj_-)lf$"qWg/D`!,-,J ݶg[n"1r[]A8;;OK (lsΗٴ0Vny֋(H,bH :A[i3Zt6`z^,ZX׼qFݒbq^e5?lJfg{fjuRm?V֢|0{j^Y<|@ ZP0m{ΖhZ_Cdq89 hl.$c`;s0Htq[h|C LGScC' +Ҙ` *dwCL>Er[ jh,e=/G<)CwS I}H/4J4}OtM6jЮ'Q-z Γ Lgq/Rr{2=F2V${%{*fʕH9Чj!-7qVZV["'/Tɍ `Ygl贿A* @+sCy|T+xFxCn׍[;2p/]Ow_JB:1\“#YYM?tŽ[v]##y,gU?)ɰL h%jT.$HF';:ǒ5O^Qգ>aQ3u3vЮy.˞g7'k{u3?/”4'AaAԸ0^]ujb~-TU-?W'$+krѯ`,ha0  yG=AP6X@,W'z֋t03Vj{JRg.Ѷ&FZ{ ؝5t],`ca/n*]p} T0GDC2[aJp>eVR;߶, 0c^/JTG/ֽ܈[MBq1Bǽf>Xl FҰ|3l b?oU] 46fLu?pBa;J"8Qsg|wQwʙ:ާNPM P^?hcs|w#IFGVhq4?j?5n,Dhd |C KBcG]#KAz(%o=g@t]oX)ղꃋ'홤`1IQkM/&t{ϝP<ȳ$b<4)o%̋#Q=$AFOJTPW_HLQS iF_aHt)E5&"$f[MoџnW݀I{Ǖ$]Y9aǦxv/}vaȦ]j{^DJ.{jѝ]C ^QDGd p9&OV=lX8UjQ}T0ht@{ח&5Y2]zfϕNķߞs{GnD0Qєc@ \p4=טIX%IZ|C0G& ˦+Q&i? )A"z Wp0}׍ׇ1:+/R䳤 6|h-&d%MFzK) |A o&rYe ]ZQ_ؐe+ DʦYdccfKU"汸fK\f'I2;qu av4;8Hu3 y՞o}9ҹtOK?SӦ}$`IDڮ>`ΥA_]rG+rv-.#pxǕkk_to֑"<<<9{+I6U IB 04NjϮ=jr'pQ ~|Ø,ηʨIcm` {?zp츫 W ">!*5MCG䑅3wW(~z/n a ޲FZۈisY80b9j5 /]vnRa@ w&(I"Jl @k'Gy>('RQ#!o%})CCRZ:M+X^[M44gakQ׊&TpӀcF^{BHލpzXaONEGҴrFPқO9'T4ţqlhkũPU/6s8:}-fVNF5RŸ9?ic$;&ƄRi@r8n@w%HĹ@ $6 :q;9cR w*a L3~3G%T|jN'5p_X:↝o eCER %gCMzEnD|+gW6v$j) ަk+jϾB$x})% rʆ %qIu)᳖V7#K<b[c*GuK5'zzs˨.3 6Э"x\ƵH;&~I}l-SǾU~";N5mPaudȐ^OA=x ;`&4(5hX'\M@CG;`O_VyyXt?f4p0PmSO4VYŞݒe_ 0,Dx TZ$2\ yRXĭnkTo\D+t(v"x^H>/*\M"r g"U0[|EfVۭ RR3;Z}FnBD  NW 8>~HyA2j~K#9'hEqvs=m)#7vh\\ uFh|0K_5N؟x%K[Ap%j3@SS3ʷ 'X/,Taq F23SK'2+W*狍T<Ҩ|ZVWo2 endstream endobj 173 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 175 0 obj << /Length 4259 /Filter /FlateDecode >> stream HWܸ|}\3>F#].s83JfuxHSGy 9)zU׈6r'%IC ^_e1ŻLޏ,±1-(NZ6g=9~޻wĞyEqzx/ G{gZVʮOo=;dN01!J|? 34̕[<͏ LvK AE Xa_Q8h0c#JmZ MW~ЈTuE gY(R/i }jZyPlv8(t,e9&bmyY{%%84ge@/kW= lۮ{%*kg W_̽hiUTI t@QU"eWd{ȟ="fQQzWl<ȣx/)m'Lܩ{])#^j ~T'6W8 pˈ d>ޑg9X]j)q;@a%Am蛑J3I-^[3v蝟^5IC%v\5beӀԢNAƜPԗM9@ kLÅWE5[s;q8% Gk:SÅJU/uWc*EU8lŞ(>.SحsHø r0C74N,ќ{, }p"DLؖ%;+94 8_D}z7#*+ <[3WcjS"{}D6Zv9B<` Ū*~w|[<=u9u{%HNGrҦrEq욞]ݎ5`@:dY WYYk>T)ʡ\K'h0Ü*;0`JS  npưP<=S c[z;ٮjv X29bl6pEm=^c?hE uysOA|֔a:DU;1d1DXXJ/kw2jjl7ΤbB>ɺ=6| Oc[H3EWqH"rF6`S)!iDү[=`+l{>6{42Fa]uE eTK-h#:[7Gb(=6eT`<!eػw73@3QNelEBS1D)X;S? He?Ggr'<TN ߦ)kZqMSfֱ8Bt)%ZZ2dpl>݆FpZm? i ۇ|ܶP1G1t=nUa > FaYɵ> R,ǀNaVƁN` 9A (eۢu h`4|_'fwMC?2i_iAp ]٘uD!)eXS+hrd 18~tA}~#9Z)(#H+qW0Gxլ0lk(5]HۭfW-TUC4mП|"$I4`{RndditP ;ţZiGgB jKb֭z/{ǼDliȨVDs#cA'͞\i6sn33WZ5jIB%w^2NN=fe)Bٻ>`Iĵ%崶 g"> } ,œ-ػRxrx٣\kmbL!:xJ74-3fsx0\^_۲1e t,3ewlJ/^<僾 aO{emqa$2NFۅTG 'v`z-U mo ՝}'f XC#,䉥iCAh}P73ǾɺHj<8X!dźWST4A$a]gIC5"x$cWI;$ȾX}ks]B||'`it<2'VeſmU^odH*um\תG-M7 .\aK0(UO(>k^7^/e! endstream endobj 176 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 178 0 obj << /Length 3891 /Filter /FlateDecode >> stream HWے۸<)MmluʱkF[ Prg&? @#j*'eWY&noO]ݼe"M%RDY%(Ģ\&EbޤǛ?=dbeUL$MS>kj.LY/fK[{w/>l޹ߚ&XiT|I겨3Flvzqhded#?S; =F ,e0&eTO k94;LUNhooU(ʾJjNBZ%I)҉tnU V5X냃_#̡Ql[J 1[UW"x^""/ԭN nMs"7 EO (ϗn=>&<82m"p!!red~Ue/qoc;/{Ў-ƕbq,OIΈ`b@ĠW#YT-!y<?ҜڃTqA٠6QcVr҇| k{zcOTC{x&^$ꦡE!*KY\;:ʓҗH3 akVKD`Pxd<tB\ a(\% h|\19'#~gR7BVH@j2SCK#*k#jvi>hvTv(`H}zbһ/tCyvpUA %L eQ W"sqiz6\?pڹ[nx"~,sЎr Q||S9XWV3gncи4@^rV(8/[l%r_+߃QPؼE{M(|Q)TS,E^2`1'T չ`r䪑MbB5HGJ0HMMe` D±!|0Ќ†+ҥBEǟK&K^`;DZ>:'{Y)OR6ԏroB l6R>GxNbxA ˩NoIXR3&'XQI:$4Y #\ࢠiĈ׈tP9~DFm̡(3]oFq*y527\~T= '2+Á2X`hWINt3V/5N#8:ՠ0/$<),BSuH{ 4V'WqtD5ׄXef)_ .F6C䙯1u.J^.>M4'FzK"Lks(/y6_A{?)_6'z]$p'"iV-.F=z"x[j q8|3⡺*/P.89\WP?Rah6S-<iVί*!K?oI, Q).Bڛھ= lg@;=U[3oӥy |R2:Mzo$]H+ۡ+A[ ")Ӄk,)UFiCm^<ImPD|64KX#";. P~ -,::;(;'}MeO|詗ΧcŎD6"+DgKw7rg ɡƮϗ)(7 5jbQ(@Y;p?UO^Mih].K÷ WϣesWϣuoC3řgF[LQL<sCXx+Zb jzp/ kii.쨻~қZ ְ4$'W[F'^6Fp/g. U'~ě SK|*Zl($M(U]C<>s sJW6K: .\0ՎW[xqLy^DY(@ٰ9``WP@WP%5mDRRfa-rَGhFɢd{V:_-€&8M"i~?c ͇@A*q%3? n-Oez3z(TcSMlPCsyIc&-˹7ď{o&2;+{0ƠH [P;'TS\u13ޝNK!3L<8 ҂4&`$AcȔ$1yiD';p,UժI7{3e>hߧwf@d5ʕe 3OҎb6{+[ݤNR@1i()|ndUOfMlI f{{`6ԅPvH0 jξb4 TZCzF+DACŚ}iU䏦}_l+_GP:Cl9օ5sIA.+IS8x4#cq8]2H{*f %N=TLK85(W\n Ggc Gyc=bpGk1d(  [,^ʘgS?Oj=8 h{ 3=__;a5H|ea"h۹_i.þ`x՞*bKEQkbnscϽXpSf89jr^P(œ$ME"&DcDKJESLsjJMzcA#:8COůWbcPBNBb \ Xmwk&j/$Ʊ YСۜo[#_=%}:f(]meփ߽D ރN|VٴJi0@׮@JCW=ɰOtdCy$\vGP?h8v EcQ?P`kT/u3*]F_/z՞LX#Y;ek*|3 YAW]ҦB3VY2GZ Wvdz?bSMarAS\Ny|]|0ǼsSo6HV6Y.Qt𹿃 2C~FP|ImZ8懷tU8*Lv߄&DEa-0+GF/@SKo;VDxtm@"KuMPMXbsӔgd/oUR'{cEo }tB.,gܽvqh;դtmsU@Ѧ;7g Y _%ާ]Şs,v7dE|f/7Z>p Y7Pb6Whm ,/ 0GLU endstream endobj 179 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 181 0 obj << /Length 3811 /Filter /FlateDecode >> stream HWۖ6 u77ʃ#mq"PNf޵`-3(6 xyГX隡{dN٧H.< xdњ'2!HxTALJv+155J5 U(Јq2NQdYer~|&lfkM .o/gz2FÊ10,<34 (d-usΣ<@Dp?*9ag)4緥(K olBäRqxWJO Zpᤕx#ՁFwDE*ljVADX 88ٞGrԍ|2G{H_l-SOӨYyCr~[i5ͫGGXF:?">'coeCo ׁu`㼛ktdW>ed/|nG A-}/ Y :hnb2=KBjq#uwqAZ}J;y`'DQVK섦l-?qqVx(ܹ+te(ByS֝q`hȺ"Q~A#PNqRoK=xN%&|ךZK `| o&8@/7BeqR}YN'!^Gح#A VvvŨޫ/10K,QEy;юSho%2.~Ov/ '{~:έqпTȒXW_R$yuTTҕ8O `OCWe^%+.u|j1t;aAtPAYd<[^C?2q.om`z=W^Y›1߽]-/7$>T`,Hn0n7Cb/l8*G/m6cA fӖ ȋaRas%AZПC"/,$/ /wPc(LA2'5[zhq"K_ 8铽GVTW%IQ J8cnMOcV0,s*HV:GjFfGpq Q?q v1yGK'Ó %+GTw4u㱀n `#Hzx9(ߟ?ΨbQ`'d ~jd ^h6 ZC"L?t9ͤ:`nW4"2 H-:6E[q]bF.G΄VԗY^?'.fּ|⶝pErq-?Gu)LJ^~S/ii>%s ]_v1ߏ"̾e}b2#II_7@Hh_ H8(uC=ĞUΐt$_uhj+…ea6tgpfj(Z'?^-7nۈ*4a}%'e[{[ X|Ty^}e >1e)/~;jAB˧@GEu;h "[@LYi [.Ăw'Iݩy,u<cSєrakL{"8uT"]`3&^sNnh*[ү .1jF/PgI6P-ޤxAhkY/2}a %-zFirM ;99RON{d&_Q )jyVЩ_KQ:b2dCO'ܴ(YQ 6(-~|L%9Zs"(=;~kJ׋iO ϴ'cƒ/eϤ=ܔEtZD-y4_MPf[j8YP|*8u0¶=@냽biVFw̏7F.v%$B}UXG֯)mM5E- YTS~7r>Jz^4(Rwי Ggڐ%aTK endstream endobj 182 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 184 0 obj << /Length 4955 /Filter /FlateDecode >> stream HWێ~7Id1A y"[RZ69#_y r ER덱sSU$a {><,%hdEiΞۇ>K>&hs8`OOt`Lt)~#{/qnݫqM['Qo ζ=$Y~ZtU~UZNLY˕<*K>Z3ޒЍ>ʊ7̜7t$mteܰ^W)M$6Ƅ&((4Szv5\ bggŸY+:Ϗe{_z0K2&b}^<J=GFVYvQ %>8MvW8˸3ğM0 :YsVF02ȨFNW-TΝpU7=wnxEtm U?U_Scls}&zuxaށ8xފTٟj~?#: ݣF8xe$n3cfM^P7s5hNs]QN?;@yǑQ-dΝěL*7@ES1O@Aw ҝZp}aLF Z]@>un2PB>.2q/,) z0jlCѶ7ӓ <OOzYQޝ@ x.m2=p2:1#pи>!=?tݽX\OI:)7\+t `~r rcc @5o>t\N( VDD`̎N\/cܐPx:  i>~7:`faP'SEv;zL.bHIQu[Sj[(^~zbÙ@aU`ݺD~w!\zGW;ᇨ&[C)ww{͡4'YqT icXo9( nwlxr '0ٳOP}FCIiXT0HXV6 zGY,dxt+)6r/?^WNUj?+AF?"=޵+3r U!}_Zj&/vv|m'HVVz+PYn<{—W׹d;B]8A6+U><!.Ptf=iM L?/g6:fEG;i~ lkLФ؎Jm2M%C]2VxHfZ8xUn#ɱ6w"d&܈n[B(uo,:xb}i-_* }M@֋ǽôKpG\~3U,jd_qq~Ƞ!zo rKgHyW" o~|sa![%B" H6!uTa0 "M-);6I*5K{q+.vh o }<_y^CwBD7]l7$:!Qh{AAa?Cu NJ~h{e&έ Ql9VUo-"q@QU/AZDWu}tVm}ֶʯjNnM§=;jvwZ_xK_T:URs>AI"ѣt5"*dpFie}&Zwџ|+-\բe@ZYceYc=G?ik[ k7 \oe)xP vԺB0fm+hfcC^.Ov"|*r+{rOOg=iӇ#B3"q z47M㑘 g박gq${.q<9`Tx˄Sp3nH|ـ]UqGL_]vy<c;gc;Kѳ&L ]rYrʢ?0)﨎h{JNR_ٓq e9=J >k";3Ec7\Y!Mm0̷)wrVgZj)S/;J n^_<%.oE4xyې4-Q$x-x) 9*e~:AS'iI(}ky8l]mns1# ZSݠ6v} /EҲRYMy)F䅴DnU;2\7EG7P'ZT!- \A !}q[" #ŌG.3!-R @Kl=Xk("\- E^ ^~"=SI0[jm@E73pE6M'vJ]os јʵk)uH'yEmF-yƆ&3҉|&$ (88-A,lfRFs6q_1>NbSjDܶz詟Q4GC /x' |ǫ;ŌvKTfG8܃lEֳV,/Zѐ0KX!% R3v!~{JE/Mdv5 )=8stb!d瑱{ +'㽱vنcH^ے[iʢiG^CL/ՀWX'-T,*AJ23 V oY7;Xs]9q ][T:qVS Ą5i%5}HZP |v?)V K9%I̺D0T2#RK61S[ڿNP@ qgj8:Bi7[F~hbD"~`Tx4T]JFp*ϟBdŖS1Uc%h2ij`T=bAjs%DC'<*dNSSYc}^ iuLٸ8h{HéEUA۵:ͮ}qꑄlBxD:&yr*q)31v #uŝHx ZeS}qA+D£bs`nBPіe6ӠaAb4[%mP龀 CQ.?'S6+\`GbpxP݃Wu=ꭄ\5X2 h*[w,taQ"M:}ŨN>;%k ryǼl/rwJ}O Tg1H't'XGaN̗^xp+kKD)(o  7Mp5F Avrqܛ*cR{7.Scvk*!dpA-(>ށ_ |і4V&QaM0r.hed HzKřw1Z7>dt /4,}G|Ѽ1X92#wl@S;L/ΚRuD|HS@:mimU%AJ\}cqjbk;i{rHEKL0e5R}9\KjFe\ m捨e#Ad TYGoTJWT, 5Ȃ$gϺpށsDODi:er>[${ztk?^f44͵9hI C TkҰRfl&U'lgb;Yą- r\,yCՔSU پc|g QwcMcA ÐCkЉ$Ww@[v!r~qtQ-`;Xlܱ 0  endstream endobj 185 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 187 0 obj << /Length 5208 /Filter /FlateDecode >> stream HW˒,{$I3N\+' $L %sD'M q_{OY2?,_VU:guMζS3_3v0xmi)>??=מ>L_#YuxVw+YμNMOYK,(q̒: zi.3h,J3nX+IM$z1Xz}wrhUL ȍeq2j՞MGk&"o>e8yW׫ڹv#MOWe;PI5|!Tu溅O쨴|һE~^JeCAmV"zUw|௻:Og>kc踕`'YA%J _-Eȇ4̈ o qxLVZ:oqV8$[qP:\8Y+ٳDf+vR!wjr%dAz,Դ4jFtGeAg !Yu>YJ,|r3:P^TH8T|2(~Grv(lk)> whU ՛t1a2+Kg -F!D{tz*Ne=.t/Zɵ[j. pFuDnjX"T##tRc.u;r<ôugɺެ?iXylrdM& J{zteJ8Y0Ie-w@9ڳI4ϓfU{ǹWbxn~/4q׈en\P@Yf,KTbJ4HOefB1! 0?ĢxӉL{ L @VRS⢦w!"Jq1KǼoQj2W<\oj Yxg~`^IU+780:)jNswhfDد-AyG7S ~8 ˜i:kSD.2YwhH}40V.caLL:˜#:OM<_H+a;-q l#/m(>@[F\Ct;R4| o ɸag`* J" KGWi+֊nrs Ҥjd-Fm-؏P N AIF'¼kFя(܃byWatxr:o{|zx@Z85N#늡ɛÙT= dUx SF-V3d7X:p/89>4ӓ~|C.ke(#tA^.v^3o(o ޜ i}8o#>!Rhw2`axпS< 0p/lIu}+цri N|3vqM$JA"w>8Z[= I4QfY|pk@dww(k/0XFXLX ~(טVx˛N0&Bh$);ٲu[W ofo:~bǣeurwj{ܓrX C6f]KdH[]~HBٸE I̞ <5-yzCoVX.vh1>s/nq-RamC^oj;_( :C_]$UbRj}kg@UoU(..qo]^;A|J?VMH;95V$ X(3t}~|Te+8{=.qtGJ7)V/=ϜYJ w0V |y:% Xp7ԻvUܶ`GHA$xLl<X ڭ}{(KVUNINTMDKnLEG{Op0$^sd{`CaAѯph鷾P1_6;X֢D%Ɣ=#esԃOA4at}DRTﰎdzpcK!ۆJkJ2be>u|.|i4iQ齪O0Ȋ1"U"j`[:亘 oI0㉜.[jmk_/& .Em}.M &StETto$LҐL:6q 4/5$Q2> iL?7[VW 9 1c?ě2joDN=zixf32`v\ 5|IlR=M |$?%?`x v%D0h $ d"ԑ&dvT]}RovKN̻VQ\&P@N$> +6+ צtx'/IJ?Zס WHR~s ҧV{ f.d"`D? Zvdw0 [R/+U28-?I*Q°yn.ɪ4ml`EoqOk'pᄉGAyV:x',aV;6r|{4XZcp2rwWrBoGrN3sڮ'TԄkv7w5-< 5FVHdho΂0vCf %r3xjʺ*؊boZMLu/g7J.~vlODb+\;DIq C1㣡2z'|+B(^[FT@f!+AazDGW8~3b.D%% z;ȦTJQ(m`\Y,à b7oy7 &gƠViUy3]cQ) ^Q9?rA>,e]ƕ9ny, twtGk =3P`CGDiOt ~T#\Jmļrh߆ hF,$9bB@[!LWnBC#l;k,n8}|EGwlOW eIoCBlY詰٢3w<~zjA&8)$QSU|@H;hk:jKX♚ iKd+{[M14\ʓ#  g<\]Jx-95E홿=%)+n*[mT l2&Fr=dx~2ͳ+~a7vZЁB` +S=xC7G< e0y" Iҙ4[ן=5\=q -FBDVw6h$%9zfdx´: Kşܴe. Zl m4ƕP8do |713{KvJDo[h,}uj!@6I44hyKSmLANP~ ,jm {* 80'SrC&礴ӵy)*P!OgBw]:.=3N=k ͳuܯ5Y? ñ0]RGHF]E,}Cg\x؏w/g)ͤA*д;TR ~):8}"ZbqJ rGɖ8me*"G+6;Iқ4QJzyVoIaKJWGUh mb&:18p 4,W뷊yGUDN܄`+ţڇw=/ ĺY t~[u>6 H~4w"o54W|>m^S*&5AJdgI:oF$l |W>;^S%yD;ZIPg?7뇊,r72!~,i6&q $ yBf2lPKiV7b$DE:xbRP-Dy{09脾OH᪠&$z"Vў[IA=HAFe0j47G8W:dpk'֙9h%޴0Uv Qv`+[Bf$4>F'Fd;轕X0Eπ-q._suC%+//?5M]"2ZHP endstream endobj 188 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 191 0 obj << /Length 5091 /Filter /FlateDecode >> stream HtWے۸F=}x6]/uMvw[ˢ*Ŋ^f>q7!!Y!˓۳Su'[w{gFnRuZ3Q.h2VE5v/VI: 4֫6+Y,X Byu#<1j/P'~b'Mqp lYr(A~Z ^1;M<3#Cu&@HK& T5L3Qʞ:Fh[*7xсٔY!bn/N(ixOw\7\z`(΢QTkPJS?;&u+rs+:4*.ifzVqM4\s  _Л(NK:En'BDkjGwPɄ/c\F;lrwv;xK1c9]X{*r@?" p[/Rc]N+dKNٺMpʀ.T yMs<'REۣ:p-Қj"G;ٛ(&b] GF :qN#=\!MH%t4 =$΀_!G^̭i&s"^#Ah(O'֩&Mb6]׍3>: 00;J,9M+ʧzp ,&gOmQա?g^[]@t6 X`q`u ˒YE5%B0b؞bY-ْ͝ag$>\>]N7^& %d[1LZ5'9D=mf Hd5/( `f[n|1QA>c#K:DE<ޕd"% BO&Fp!kny_odI]X hQ}If~в2,:1EPld8 <}h- 9l`f o2^әqTnRj̐q9\SR,H\BL|1dsa)|dk? =w֭ gC>E_S$i\%H^1\ 1F2HoZ4$TlsȆQZ~mA:ǾZ݄^q5Q W$d,RT6TFe "K8R)# J4iU(P'|仔w`f4z9P 6il_H9" ] ,t]keBA5BabtCTF:*̺Jet-!7rz>;^mn2k?P1~UO iqx⯸euհ' F1n >71hO.~Cu]/8ɤ'!"BkxŪ(|iF]#oM**Toc #/Vb%o,TS k~*pVm))POZr?{?`,&NQn8|Uͫ޻bAZla#Ӑ]LArX-xȅPjToM=1$E/dJ2m̤эn!-܇^sp`@"ƭ~+ΜZ m04 |BՀY 6ag!qN$-.8V~Q_HE@vy.咉 В;q'KW p!Q1{$v9+|l+S'(N H!iN2c\Qd;'8Of _9ӘL%Z'$y{h蚐cɷ*U}^9?]͚y5" ȤHQu&U(h DE".tDvnGd2sbqᏺ̳S1TO(%0O𝀲p%#LFS\}åkpsAϠ~ R]חA5K7׻dTz/1 1")mn7;ɑl-/VONUwSd' 6`K:u.Oa~pWHKHxǵ 8xJa BX3jWBp L,)VHc;V=_C"TNS m,q.V+llU-- ,O.zhܫfK:aU]erKkhc{i7L_%aKio X NG UsYdn2he W1V݂$1c:ӂhƟ=C/Ͷ1+YRH"kF'G Ϗ4&-*+2Y hɬTk6y?.> >V:2\PX@#!P$t:c|{Xgͼb$cw1՜j|ú2H$(HZPNJJ}XNq X`J6XCeQ_.:*f=mZscO̓ɭ &Ad ʍ4 e2rܐ3 -ipC@Hht6,h(KEi쭀 ;ʔ4uX< A6Qͬ<-4(#ygO-b& j~h䮠AYsɛi!cِg8ȐծTzMK0;`ƨ<Ё7D7=815vu(zɆZ͔IjI`3H[a|9sI} <^jqNEpЬP%aȞfU@I"iuqecο+p71D0EYIHZ 8y1Y<;ĽRbvwlz%0~,xh욍77ޝc0`~ȟmx|& ol!ќ1`i4C!y=sėEn*iؙ'lm'^r( 7I^]aeOH'\<{ pip% 5L_pͿCDdD&h*w`HPGf@f 3t+pnm@Lz %XkGڗyf_a )`@r0eLg bԊUrc#6qL6eX$l.cq}1;C{0\lӍBL,#\Ew[JSC'wC[=^$j #0@&Kp4Nv/uX)Ud.#kɧ뙖4y]>'nIpFW޽5|4_ז_6qL9B=vJ'gu\=Ng3VD-4?Mu ~T7d/e2^<v܉5ǒ Kj(),ZC{3y9>ArgP7x ,;g\DX$Z'^˳~[x[<;Kllx.o"Gx&ZN͡,ړC'/s붔&tf%)ުMݪ r;xxsY<43U _->]P#]B_.DvB\D[+xxz :82?x`܊,c̈/wynXa "'$Nex,tm+W_RSNH`]cIC,,O Sez'aeō#˲hã}zK*+^5fO.hw"9l&S/5-Q)6sыxhFwҚse/,BHT(x!^]2N6ۜ FYΒnI'XtD9WBUYMQRyH(FQS/91q5axNKZYCQtWRsFLq<u=g܀Vo33t | Df{%TɃqsuC>{YB*{pjj Yb$M!=:$/0!ak`2ICSyK' YA1ktSM7őDM'Pmk`p mǭV8-e> /ExtGState << /GS1 12 0 R >> >> endobj 194 0 obj << /Length 4505 /Filter /FlateDecode >> stream HW[۸]AD$8tL|@$$M hv4I%^AT$yon^Pdć4,  go|Ǜ(ٷ7~B69<ۜon)}|c^06?+Zaī\DV䍪(I7 E^G YS/@ө>U+;um6 Axi$ R/̲6L1*b,'޿}G|ױ^U /@"DOC1Tى#D CHamB 0&UC VTSh=hImɦLnSy߂1Hk/`Q.d'yDe3c3]eHhVL\`d.;Xs):fLԐx*q#ؒ?Q1w?C 01!NZ%+@c4HA&G%7[xs%Tԧ.Р(id` 'ƦI3f74d&֡#H[N!΢Ǿz4gP};9X=Y NZr'`yA0~X!ۺQzpuKN("p4 W=ې]Oqb^ r=ac M/XP2?( O. !ٕ&_nWJD12h/F,cG̨fQtc o! ^02g<=O094%[/qA>f῟;5Y4eO}_wxޫxN.J9)?c`Vu@-q&Zz?nl*! Gwd hzX$z^<@GIcS o8k֚?VI}*#p#"{11$b;䩺|T;0G%I*5RnKY^X?_߂kĞ(t[43/d˱ͬF֑QНpT޹6{P Qy/5ċB,?G2BiI<nCX[<̩NB1eU@H l;LpG]#AÉv@3(tS0rb4Oǣ2@I8Zⴂ!ϵ06o SWLP DWJr4#ЅfeKEadI@ۋZaMt;BaVj'q%k\\Ep3Ǽ [7ݒR>R*oTZ7K)y%,NLb3aW;b`r߃J//k$˗[y%CAd`*k֗a {jZ_, z/yY^fEo+ol -G 3\ \DI Ơg؄&9m?j8[nMcۼN@kp6̪m嶪\-3,%]bW5B6@k*4Gtod>SZeY*4ITZ >00XE;@O\Vcp>ןao$̍&{3)y|?6c;ۓ*{d؄L@op#ȪFB b\ IeMdErJ,[t2>a A~ hE>W; I'o8𻬸Y 1ga(V"?"hqұ5,Bf\*Uθ`+vroKػ\Ōyzeo]dZsU.of帿,F(hg%.L~23 (9(P(.&) u`F4 ^^fn j^AN6:q1񂗫c Bj'A~n@TGʎ3awvMcΥ:r=S ފ~9.cƏ\cӑxSpVajA=/- )/},eQq3FU5Lti:dqp|{e. bD5<[ҺΡ";afo #w0:@&+(yj1h KyD/cG0)efSRib@3_?.6e7G}]B2 o- 2ˮkST'[bad9j6>[߭##jhwK׸ X/&}SK)Cn|Scf my 6wecUJ=`+8Gunuڍn,"e L? RdY~-aDh~x`Jʂ19`Ē$ gx`?l@Q>(O IF=_]MO%q#8/ЖM`cԂh3ltZM5DL5/?'t'2s}7}XMi\ao D RK96&}b:F\|).MKhVm_:1KN.{E.E ,zVSqj䠍faWԝٮ-[B!7MY6tfWޛ`T"gUd2'|8.[u&띤lJ4s̶S,;Ȁ'wR.lz1|s$MfCT1lma\MA=HbtMY)x f)3$ ypvLD*M0.\Gg`L -5g{kÉ]iSiٲ~v&"!7hۮ/< <f -`=JSzXC\>Gx5$uOXCǢ6):'Sx}4< 6\:8 'Md:?Xjܡ @$~@Ȕ%TLi#ڻӰw7G}g̾ CH7I7d;D@JJA%6gS $c8^-zJ2yeza1 «#Ր{o$b>DE,jrtg\)d3.EAP80]8}w"qQ'Á)iQHsDn+^ qHP50P}}i P?.e4Sʈ~Yx9_ŷ>^bs5!uSG|1tG&7`?bktqwFGS`_m57.ɔ `e.E1?; mO^u(^+gwcw?.Hmr9. )0\C, |ӵznIcHZ: o7\RvGv &+Fmie(6џo#|6/T,$S\h~8$%.E=7$ԲGHӴVT0%mGie"r3Xxweഊ2XzD' bׁT!3*$R|𫺛;ߐA{ <#*BaDa0V2͍K] TU:d=ZTY9eAehR%4O|9c*AE yj L MpC5Jfȉ谀otJ_rfm:B Փ/)O{SKD$|-Yp6+'νt oK{cl=ʜA,jlgH`]īt&yGޢ*?Y ZC O`H<\=aLƑ> /ExtGState << /GS1 12 0 R >> >> endobj 197 0 obj << /Length 4437 /Filter /FlateDecode >> stream HWۺ}}OKʟ"i d}?Dʢ+JvlOϐ,E`cp̙3ow/? ز˙9s/ qE~7LJ5, sBX [xiHqdjtE'5ڊJ)~ŖTuOߙhoJ ksaM^9^/22{~ƅOJTU-Zsu+E}dA/ɷ%pݮUZe;ʜn!yC>, y^0T-KI0 ?YfV5[tE^0ԏ/< Hd?ȓyG5?uUB g bdqE6I0w#Lw|%kIYŋN0;V]10-b Nj5BANʁR \S@J ]KJab:kP==b73ۨVJpEoU^j;EG$` nvÃ`妷nY)KTB7ԙ9,;Jy?{Rw\wtLN8uMwǖ7G2B&+ʩS@ڡdhUtuDX7*)[1smx]m޷8h^懍,6Cc/STN )\БSXNU{K7nC6Bו ZxmӮ垠wV[@BOV-%.6톷j~d:PX ٞцUéGw1w0d.w}_mR 2D;B2TJ6 xNؕSNΣ S?hP׎'t!K $~It 4U͂<O2k61}ve7n16 f’RBt5Qui[=Gi?4嶯jm LN(j3 p,݊`dGY= ˙3W'dc(d/-U`֢8gb'aZB5'|glu=L #Q,ٚn ;|Fk;nN$ 0a{8uo h | <"@gS5v<9V(,447eRxk)>>u踱nAB1~C0G nEB[~r9da֓hP7|~O "Z{)ǐfkR"C& U/N{k[ VpQAHUlDD8!q:ŎC洋sg+A4дOty7p-涩glNS ^YW4J֢[[t tqQ^~8 AcMDeƷD=,O'͝GKf:lG'AmpIB֠{eިζVBǯ|퐋cl4NV-YN]CW](U5IDߒHh@f:oy$ )mdK9RY-ubޥ 0 9 0E^L( Axn_"0 ~㱳m--J=[]&ٝ$w L~5t so]W}Dnk>cyQ m2c:RhK,G=A4 =M"j"~(66[fm1F&jp6ړO"@wHP`mzt,K8s][/w'n{UyG^U&X^mxR K vCa"d?_܄*0J\?I AB@~Igۑ#L٫49QlM+"!,[W$3E(Q裇7Ib7Hb 8NkuC_08_az8ͼ,$naT̻[t 3 Q"?tb/'CoЗ'ʦ e:B(34>P n7ȐŘ< K2Ē? ZO7&t޵XgJȊY$̍u'Eu8 mD)\ X2VsLȵRVpdž]ZI "z4ʢ5 ҳA:D{*~"vtBؓ7l9P]-L(Q^ }43{՚a?@F9({Z<B8n(gc#oƧ$= /!d_z14Wӑ},Md- ][bֈ~P)U\c?+jkl d9+;\WlnIzeU ۑ5NɆBeႶmoyITHۊ ۀw=Ð> mQ .:ݝ]`<u~:_V]{P{9VHoHJU!L4Uy%,aS1¤LEBjm_cHZR/KyvYrːSCګR=#%HN~jך|&lq9s3:,NNޔ[Abd*Fͻd7擈h7KFUTl"tb|8K[\Btwu}ӔB%qDn8VtY@/J"LuGO diw;bnwBw#h P W:9guET`RjpQ?R%ϴ8﷪v•.mpд$-j0} 3uiW t49zT)G\~9yGj /Rw~Qօ40&l&Xk=RL{GyԌ y5$˨&g2~X& mɟ=z <,!u bs^'P7%8 T@2rL6=I۸#n67Q@_;1d^L#ejY/ xy+ˇi=Z*DA*E%nkW!(*Pizخ|L#=Ry,sdx,*UP P'xnTf);m[p,NKEJ=0VMTɍl@&:Bk:Gp?@c܄$i`zjjQhma @aK_, N FcNCdPI2]:L~q " DbA㿘@z: -dpx>hp*ߢ Ӈ蟞C:SFa4b(Hs[ue 6Í- "IP3]Ӄwx 34E Z[AvG$ ݟ?M}ue +fC+ZA2] &=%fdqTrȳ; '3AޞW^o,#G-5"cY)B=Ik3|+qqM7s ߦq(j.e,h-{!IK{B ak/G p J;sSoЩy7@7~ kL[\ u>ShVyeh룛$^hR`PX3atrk{:ɅSm7̵DKA ͭX@p2*an +jP&2&S\)m┅33rкd=^bT7Fx7|dG3KgIJ2&.YӜoDs5i0=C_C&H8S>w4IH"c9eHvϷ"~roTpj%iu xl_kEPA抳fq'/cj:-d_[Jc*DŤGJ]bg\՝-IYUOzOcZ6͹&Crk|#OtQ`xw SV_LHM$g C")"|b",^ntY~X̅q0P| 9c[ٿ>}6r n4̢W>h%8x^}utꮶ;\?%pz F}!/aO~w.ˑށC2Ͻ T3e Z>bGakZF`!9 endstream endobj 198 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 200 0 obj << /Length 3055 /Filter /FlateDecode >> stream HWێ~wIC`obgXgZTK&GV2Hɩ&llA"zԩ%1Kff1,[Q*SWQ/Sinbco~7.8맛w'V0ٲoTkFh0nj|Ų {<'s:nn߲$s"rU$Z'OQo{qPZ3ow$#WC큙BP&bgCo^i9pǩ3 펢Uhy=ZajOoZX&pW>UGg8Y.bZVe(MgyQesY Z&e2"2Jʽp W}^*JY6]-QA|G4B oINNas&QBjO< ӂW='>^Qf@ r6&ҚZ0Q5lp25\?9i sfXLf.H8V D5vD%(\, F/tE%>sjߑW#xkAexA |+pj1&O˝rLk@V Y>;M703:4H6{<#|O•#?8W|'5;.4Orھ 4Znz4UkVeli^0ҲF"Z=-hl}鄖 |9F-NjCP'M3tfk]P FtV XZB?ŋ6g&2w$MY9 xHm`3x0;>X&J|]C +bVuBu!bCg&#-L Y ޠ2 #*q*%O<E0D[zYDi5]پ@AJ$r- pO,L'6]\2F/CO9xh@-%Z; .:b WJaT8-5͉ӑ?zT DG>Sx\ di.ieiPA`W )XG"()RhjGhOrE6W*e\Øus1?*G*KJYgD̄̉؉iZ'z&pD%܃j%+}YMW+ۏD|0k AT:!b:YY:UkV-lzXxxcQ`H,g&ˊ1-n!J+z{iؔˎcI֜4qP+=(8 nCzm]?e#k (^GýS}حt5 r P(mģ= hƔjtgCGy <1#NI2hI/ 2l< ?kupMUB Uv wpCƈbqML<-.Ki39&0sNz2GasUwDKh]P Ivo7%~c8v ^O,O1$LdrP]!nldyAW~eXkiƃoDR\[D|ؠH҈hyU{loW>bteLs/O?BD;R DvY33VbKerr=:2C< G*y-݇8khP;(Ǚrl3rs}E~xshߢnl, jGv>ƵZ_:hZ^h7@؏)▐^[+Q^Q }R;·K=D2A1 ,'1 J;w[X*U?hZC+mrBfEm?h +6NuwO`36Jlu!t5ofsTcn]-.R]K,S./te8jw% 5iCb ƨZ X OG #!E{⻝WˬΞ(%"/~h@`zq@)?A;a~Q2mJcN~7`%T oRgU۠MS^bGИ#l}ƿݙ\Gu2wy{n{zRɰ>wBTGKIЀYI$?ƫ)a =420FxRRTnB?=x)OtA-㒽ϐM.P ܑy\joL0JZ;[@oBf6`hH:*"Uq k#"8y~hQ.V6tlJwj!$WjgBBꪙm|.c;4jdJfqKYt+># ͵'q$]^ǥ E;ϕ@j55eDz oMu$灐.jrٛ@e.Kʯ=LǮ endstream endobj 201 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 203 0 obj << /Length 2874 /Filter /FlateDecode >> stream HWr8-7'LyfbeS>@(aM\^sv4JdJ%V,їӧO^\E\ɘF) }'uÈ-c/غpubwq/"kN!n-H~1WB}j\LV썪~+Q7 ENG {ﺾAS}3}[~䄑O  ٸ;|Mcr77Wّ8p(LV=d經"wyn@Nzq$}OWLLYtrȻ-6՚QE.[6%.I㥞o~ owwoҀ8vb73qiKD_^l!XkѴl'|n+S-kEKXRr8=He=yXld.+׮b7ϥ0lSx]l)c28fs ]7Gu"';x"WFTH}) ]q?9G*\-"8psf$4Lj>_ֲN ifR!N "XKQ V͚` F䣶j32K/VTJ'#B<>zLxs=NܨyDq%8 m#Q T- CHLЏVN ԸZkkFjW̖xҮD?F>C}uy~nڈrv̌Ga2xv^ QŒSկ7~⪮K,5PqDA|DFDi7>P%:B!ɑ[o\l"SWިK>cߞb\(,^rٺMm ~`CMv+T, nA8U e߭qfMN؁@hWb=pXG?t;t;;M.ΨZ@=w鹩Ae{?bxp4EI!)IMvw0aX Ym@xyAdW:ص<]ͳQ64pH L oL%Nfvt?=J,&9Kh\YBe޹4̓'&elvH'1ͼ %/@z dCsi1^6(3NjCD}tjF[Epp@Ɂ5yXDW6:+i}g3|D?4b?cH52gע׍t,*1ú/7>ezZ|Xʄҥ7Å˩}7bFZ#kuBTYT[p߯ w?i#uOpp%g_З'U2y&S0j=:V$B757Nr0”f*#G_őgF 'Iy>/?՞3/>\9 xv 0KSL%em4 *!lZ|P \П&HU-# AБKBR\zFMtBvw[gqp#ߊXᬝV M8Å-IW-xf0\fm|jIFxMBhœmwC艉݆c9~O~ehe8ٗh|ôaGgWǦ;6Ks]PVQ6աQIw|׃%z9ϒ~+5JH܌<~wyyD3< B5 3qD&VRiib<'΀gS )ILDk4H)48zu݄a= OfB:}7wZþ.pOMLe(Qzte&R[6֣8??4~D:AbKf>h-Q#5  hGxk>^ZbcV}Gj;u$BB\ƻE5Z]#Ǯ6 g;ZFJO_}*oe% 3}jz%1WU@w`"趝q0j+[=K 4hQ4vR3> 76[;?2!,=Ħlr(|Х \q&P z}tZZ"(mg^@n⹉}x&_CҮ`_k:c 12&UϞVZVQ\/u"[; %ʖ MBC}yʛCӥ)9l`AY71;:Ƈ(f[iw(vOXa 0`z((\CMx11vd&a*IJʃ4Y5{ ٢Sbc< 1=Pq*aje.#=wL0&wFAHyROGm5%H endstream endobj 204 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 206 0 obj << /Length 5013 /Filter /FlateDecode >> stream HWYrH=YBaτ6/j˭hIt(ɜC=:1̪pHzˋ7rc ?g:Q9™h{l]=n1ǂb:[Y,l /(s/j2U$9`βj:+Vapo %41~tDx;~ת-nbxą)C!#7 d5FEiY>ɺU?MRerY׀\xI[ɦp>\τ#x_M|ߣuƛm6AZZ͸70~ w@_Q2)S&! RF ,,,-$7$dc\x,ءl3 b 1/Ǎ-y-s|1Tΐ}g$`p*`ˤ%bg8j;E,f̊N8v a~/mwu,|MuؤK#UPXuZigIY)R-Ie6 kp/@MLe Ii"T yKL]ruu-*El&^HoUR7qh(ժh}ٵ]U RhbH"%bF݄ >gڲ HΤjk goK^e=%.W4SaT-2: ,yMtǂ7h!k/g,UՐ2QukvFZ"pjx 5/tiQ4vo`dޠgvDU-4)|kZ>=C^`YѶ8t]<ݔ9&eH(2fA~'jBnPP5) |i[\=Oa8Ebاq[G뇣*BM<^1"c2Ur Nfw.mu(j #9#l"5v##8Ξ/^NG,WSgٴ ônT[;2/t\| \iR8|m?R |c䲠JU[e.IS՚ʄaeB?~Qe=/#O&ŀ,ld783^9ܶy--J%隍S/]IDqٽMB9bp}ϚF7FDU[7i ]ghCb#MG癥ksJfXlR :/PS_TO  v%Pw 0n2=}08+ōjf@/clJ2 ~E5|DbLWnBk,Unit ( -'h#ԏyNr_ l$F*C$0#xcƬf]!qBݷcEؾ$B| ::$<ʊʎq'5ׅP,p9]?9ݍ(~75p| Ff]iOpTKф|*͎ԓe3,CX[Q<\8s];G;:EQ=ɍmEō:A4 }xL HFS3jNtݦعJ*rQd>uC9XjU5=4aH }  {CoDAV i mg'LCL? ZlAָeC4J/Mtj ; ,#?<e/%(=JQq_ѽX~s)`{ΦNzQJ ]F&x݂x@ ؟Y?77L77Bͬn#~O6[7 sacL!Y\wYUErW+=?rK2z D4Cc>g:N}JRduس`7x^L|Ȋ3c.O{^~e>/X6 \+<5!*|Lk`$b?duMEXxW쑭(K#뷢NŒ2{w'!l/G〟<4wNG͡v.U]PD'&AԎD3Um_+7IWkTq9㴧9h~#=@XA,XC*y_#39bH}\ݱk ۡ*/+M۪!Y}ql%dOiò~LQKkUs(^ȟhbƉh9! 㠀LZn侉؜E4E?_vm~SJSmxW8gkzhӉW3O2?c*[?ƇH(SMZM| %+yܻ x.ΐCzkN3B#Zoqz\|K@tuJ^ %F,b >Y78ʤ:s}'${h=)ŜO0]#|^JxXo~SXsQ%AL0`l09m+ùA_VÕ!A7\φk^0H;kyڥwhzI Ǎw DVd]+(eB7 tM ltCoޡ&f'pzVxjH.wEC!<μZ憽l51}oUb $7b+Fg¦p8"_(~N6;!vυBUR(YsS̢StL]*8MAdϣ |@ݽV4;|Hp8f&rv{ I}+2%a k!6 6.#Y)LPrggkPJC)~n6S~ۡBuiSm*zGzitŎXYWdcZT Izdnd%h7bIJxOΉ9~v&&Z"rO]Ak "

yb>KA!%yJ55xXo ɝEUR{"~XCĽ#?AGs{{JzۀGo]|N(4NŔ'^N{R8_*GL뤪E$3 tEV]4DZ1*7U^gLg: "B- 7 )'V˥|5J[fPi ̋h4Z?K#}l KJNY/=SZ#m""oQ>e{Fs1gΙ~< r0\w6jyЦ9/J8>D6OV!.<o9-6+jr"hpai/ۘ4z)j MU-SQ76_$JvDJ jQm0F^3MHX8\,+}acom9/ #?oo.y>] Upjdw3P`O%]EVu~l;{ǃ ݍ.f'2fR>JԯQEvyɴvől ^ 7*]up(DRt8omtVjzL7 $r-dH~lhٷ"?>eLGylEVǦHdYIȋ\WWʺRM|P'VOYՔN ^-˒"!<1kUgY֕<$%Q=@:Vua9 rq[z<dl]f#rOD7[pR endstream endobj 207 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 209 0 obj << /Length 5169 /Filter /FlateDecode >> stream HWr8)!ovlid bG̞7V:IU$=RBqC℆KmN`ئe:13J&[P.2L4M~QC\h Zs˫g+^f䁗<+uWq\yQer5NEIo/(eOQó\a_:jIGqȔ\3^1rcog4 oDc5F蛾2 qǭ 3jw.ږ.ZArDYT"v[^N{0c~5!Vrcq)aيܗh'z׻p]O:%6{TyɘhhX勠hPm3xz'|ŧ?pݑ$ %1.j/ H::=k=,&)C}᙮PG4ܧ;z gMɇV%aGuɟZ R_4LSW*1ٶlp,. P%O)5ȝAPesv'TKxƲl%}ZIR /x-u*6Y ¨em>ޭخMEҼ^Y&9Uj<=JCVm|5K??긬H]8u`znogۭAן9#bʋ6TА91;p/%?% /45m - lۆg:Va< *99Љ;|wm r~ ӉQtK%^84fMj֬ȇ:b{:_7?q1԰`욪\; qSݍH,(fF|yP801ɶs3qog,^ī5?o?d8T̴M>Qb, uFujeUGOS ڐP'1G'ɞ5dmӧh nQΦ7됞ӏ@,dҴΐl.tAjS~c%W|S,["i_[l p&'MU#DN;r3%]:eqz4e=eŇ>0|N*Kf3Ȃ2"]59劫<ɷnFyT w.Az0DžҼ.J>,*r2GX#+ lSo9-ˀ9 Qw^anfraZSmX ͐o2՘O9Db'e}t-ƤKc#+ ȹM82SlJ򾧐xaHߔ^#1M6 _&gX{g>=\֐TUܗ%A=}sSa-?g|_ OT''ՍPnԌ*6e, qђKu`:oYq֤!zlq&"E*"_Td0.s%K8 tM}kG)a Ԛ=UkeC5{:/ `T2eBkŚe-Z[t(|돰F)-9`4DF1q̨O>tkܻ)hZ(b2Cdw[ݷ$,;ak$})rEL*D^C p.1/{ qւT8{J>JwKr5 ˢXuLYkǘ')ěvx +aaR㌝ɼCCzk:<o%}/-v3/6FvQfT'Cb{r?nQŻb+@m\Fice5u1 ȣ:.QMy*@bd lVbdzC_+ o1E3l7upP ylsaG~~\/n^.({Fk>BL`O/XOOZ /@s-a<oEk6V%TZv[A 8MJ )C2nB2VxFk~wR79"o ə…{QHS˪UƭHU-HB8,v'3rnƹ: >1b14$H#YȌ\!8 e>щu0s-blz9rTjԸ6IHӠ{^w~Ԁ,b>]S뉝ؼ:cht! tc%1}%}roܴl$H(%aG^+ \"q: )m#OS!B{RxRR>4"Nj>7| &?bILK4hobxK* Z6~ X!n`}K~z+>&Qcu]JwaF@[/E,?ĤrӂX,K8{,ͪ6z9].g~J2n..s958oS<ۖ0"C~[8Ie~}ćH`Raw@L:.q8yVGdȂHfVOY,2B1bͳX-+-kF]PJ^f>݉*Um\ g X DH ,y?g0[ ^ɳj'ٖdNc2Uwf 2obJ <I6Orpc4B| ]TsB !1{4HXH7421Y]]@Sx#f, M/XÛIhm<'*la3rxH{ؔhU˭L`r;&\=%qU*JYm#w*K&OWl - |AOaRbn fS;a0 WoZ6f wK'v?@Sѩ[ <&XI/՜oqZj9iΌB:TjB9Ђ:S EuґNu`9xǰwMM'5Ų̇ԲaIsdxufMU ܮl|C3 uMuq: 0mÆdf:tV9/DZ W|R.-A6j_.+&* endstream endobj 210 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 212 0 obj << /Length 2813 /Filter /FlateDecode >> stream HWr8-!$&;N|>,Lϼ ڬD>Jr/*GoЛzgbw&)4 fF'o{f_{Q}D#8%?|-s^|[&$M]] !uӉÛfLRG )mBVb!ʪBKQ GX~ *jQa*xnR&HNVX=~ (x#:&Ih301/V&u)J> t&2,U9 >츌&͛ dݯԦ{#Lu6߲ };vf84zlя;7 įѿň Fďq% 3(A{َ-1f$L-#P_zwpHX`X%R5j0.Y!UhNO\Yɋ'xJpR (T4H1Mbg mq-F,eXTlmXw32nn#Grk~Oi=h[=r PdE:x{!N耢\eR X2:h!OOԞ~Dg{Y&'ɃY\M^eBSԷ蔠 F"x'}̓#@;.}iØ>],*7eV.ce2c,̽#^-:]މgJ5ւsхD ʥ)@Lg,ˎݺ&srWmQբ1Am*g;6m|zxIRzQ@q+r`k=8V0$|d+R+MɾQ/LEnin eqh]#F3{*+^Aa m,T՛X@ uxkFXxOWU>ͯNb ~)A#Hܙm$+YgÒKk<7SAsRW/3ky|8X[-uRӶoղ.æv>:@KUpIˎn!fiW,B"L ϓu)smB:7[@mSJ. ^A_Aj[3Q(Yh:8M:~ÓFM,$ 8B hkV*S N8R,T!:xAi+rxbn I @ŰZz7H.P{Gk-mdSL4b}٤{7l}* _UVO\@5Or*8I2HJI5_2j\?&+0~sbEiߟ22,$f+x. 3h6 ͣ؅$vkكQ/Η:~{]|%)RciP^r1FW09Gq7\\Tql碖NT{~ )ǎ0P663͵jM3lDŽjr^0# P=jqkyznU0(A_wl&78:$Eق/0\{/1$hY8+#d0sw>p{͇{7JHIoHqHsZV. 9T{%zLK&⠝P赤")Bܽ;QNl;F׼1x9A'+'̴!Lur qRO:0mmgՙZTm^P76zN60I4Dqj61wFs )sP98 `3tk2^)||᥮Rcyg Vږ4XJz {h-y!CL_K0OX(XFw?"!;ab\7#t曉ヌ=Ku>C `!O3߇,"1?.nJ5YtntV꺼8Ϟ@Ύ)) TJUa3p ߝceX/z(5WBVmkC{ {3EnÂ_rcm>4D2e j׍F3?p-'/{ endstream endobj 213 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 215 0 obj << /Length 2058 /Filter /FlateDecode >> stream HWr=)KμydԌv$$1 Q>(/$oadQlt>}p8lr_΂,,Xxls3^~=S)ls٧Ϳ)oK([GIq6Dh Yհ/ARŞ^)[s/Ġ3o ,W lG^%K ٢DPlJCTݟcJ6Lšyb+E&_єQ={(Z5{IUQ쒡S>pAKxQ:(SJNU)abJyMǺK|+2Y]2 _ MfZNWz^dwijX'kOq`hԚBܝld+jvlծxR}W=U/وcn}Uu"J'nATf}SԘ`GYT۪`@&oOS'!HYʒU- R*9 aaV(UtɁQS#c?7E[mˉNPAfnI<4k4Ngh p!%ɤn.]RyqA>8'z;]-Ү0?v=3z "DkN,wi_$Vcմr'rp pF''жKZ9-+ށ$%9\Mo=\?ǣ/44̽m,5Aڑήƨ5K4Cϲs>bb _O $d5*;90{^X Ol&E }KTDIPE_Aev}3 VE,$#]dtZJF:/?lCF@I+A$|#B*x9M;J -D}0Z M:lQ87Ҝ#kzMk-kRmjYՒuPurN׍ɵLduY3f?='Kn&tk†$+gGh{dđ+/+E'A2<5Eu9j4딝Ik,<ɠP3w4ļ_-nMM_ui2(4/؉ +z'=2G b (ZڲD^ 2хj-}jk+ϥ4ꆿG[zt< *'4Y.k*b rCO̍ sM-"w>|WLb/YaOM=A. If*`ά8Oo(L\mY D?(FZ@IN3b0=}R-r ?Ɯ=hY\ endstream endobj 216 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 218 0 obj << /Length 4331 /Filter /FlateDecode >> stream HWm۸=R5p)ԌOYVr\L~@$$aE\Y9D$k8)$^nܯ~x$,aUb+Y,yY,Oel^]W?<|J\Q nuNʛկ-vђ,Z,Vo.w*aՙ}Fp](Pł&QǩAv_T,g_ 3O$IiSe˜-eeFsd6j'ԆmeeH=cqeKˎb_spq*ŌQ;$Ñ" t~v-YnӨA'?>޽Y]bOYFq2gE崾=sOOta' yǠX +4Gœv xrl;E(ڡHK_q@`ymQ@i "3ƻ전qMVA˹ JZ`r=-MwLI-?=E#8FC`pѼ @F8jAԬn+}<)\kmͱکFm 3_ƾBG zM+$a87Ŏ?Io"NvD+޳N(ҼZ`U(W%g')(0tST _l.PmQHNL&V'ѨuHGlF+-}{"rUF|nT&TC x׈>Sg({F T'šӹyh3QV@ ;GiOe#ɩ+-CFi9Qѧa2+&fP}#H5\E%Z I0$Qd#CLK 3)flQGE0Mnj,q1eKjAfdZNtbX(lB̩Cv dITb@aLJ]lY-m`Mm7cGZ YVqÀ@gM25m7^2Ǽi%dBhʌ(  9 fv$w \|-Qxr !#'%V/LH"" q֤"i* c@ak7Y; ,D*{+5*{tsM.99NٹMGtl 梬/h~ՊT&LA# L~GOA<רkBE4hqz:wE%7 .q3 Ŗ(턳`H0pa}qW%բւ /z_6wnJ8 ~D+[Lgy&b1ÖgirS3Th&7siH )Bwř,9S/k 'o-p9i|lq ʍ!֖A`dy'~?^v0\h.,)kBxZ qAJr2{Mϼd)V<Y _ƄIգ8N]tI;Hx݈^<90dG,m]Gj~O3[J;qC lţ _&STqԨ+G ,~s]xGr%>e}YGYVEEh?mp9B;0jaH x֩_햜`Ax3,BF5 M;7{9lHuӆq| oMAҽ "G^$ j(Mw)Փji 6>!}O]AaMآ_T(ׯzWNRlQ@f.$^NS T*phŠng/p7[=74/ôY.MxVm-V*Flix8e*8g^[~Y5ԩVAyk",;LV3w_"^|PHXI {k;"q'sj4 '+>g vS %#4}o,EgS6<=z "p$4 6A2.Z1 aӢ0k|ԻYeUM9 Nmj3hvGjq׊ց}? Ri( /}E"ƚb)rArv\N-.&"OhF6! ާTH;D5ۊ@J&Smt"MT!8! V#gA=:tv5Xtx4xwaJN(L؇q+#Te0o@h(Pjd"Th~F#0k0yL!ǁwЃvosdpCG"wOZ=6o|1O>ާ`|UQaLdt"{麡o7^FDw򧦷Ӈs^`N/ *Yv$w_m ? yצ'jz`8% ^x`8M%**}4@-5cogj1Mutϧ7 Z(u[헻}ۿ?4k9 _Lgt)seoK",'4h`\ܕQre[|Bl\X %pgmSR#0[.rWoޅ.ңǙhm]pG{ݥFŐ.=X8:L s7jAnb2Rdd@^]fOovyHK c^|ӑ%56E:Y1Äfb h+]}ӽEW3sBV ,`vY4d6UMFmH'FWCC9AДx,#bQ9 p!~;.D\{ <7> /ExtGState << /GS1 12 0 R >> >> endobj 222 0 obj << /Length 2143 /Filter /FlateDecode >> stream HWrC?Swه=̮7XyXLA"$HL*nV\I8}f6 n?9ĹQY"?aS/|.ǻlbm˲4uŇMKݲ˽h $\7[|/Ysٰ u*μ$3 <܉(  .^j;`]ǛNn;%k|9SEɕtӧ#0ʊ6w $=%kP )?qLHђօ: $4.|xhd͞k`C{VUG+ٷӑЕsxRm)}d(NMcۓ܋UA*hˣ=^,ǢhYm61a3?2q\\6_ ^U%^?P)tIOs;;ĝLAs1h{aA1')H^~\ xuu C/M'(4(.xXU]){҈oiRrĵ$%H8;ﱇXVup>c9)A[g쌥;#GZ{& GqPèlG[4;jF9Z% 5z9?-%y-#˜)$VxaP' hFɘ'{abO†BiBCh][dU)\ZMY&IgB#o;Tq3LC4P̓f Lo#Q;av 3nj:0RO?BwlI]<{34c#õ\ZBJ^Ɩl270#()ѰSs |Q TB֘+f6B&sVpm t(/Ǣ#Z^PRZnm-2F*MzAa:uUZ LZOl='q^)pȇ(,fB}ѷȍշ.77w7j0[axY ˂46Y5)ϧ ́=E!CPK]$?~@<gh,M!hǎXABopv}ca (KK}QƷMk&+]ۓ ۓr,*h.3&:~dzWɩwPϟ4 .nDg8yEc:j@"DmI-vY Tzγ.vv|w# !kB5 3g5N ŝMt+բbe=aHwLg/~FߍPHYquTebTArX CNsvL896(MCC\ J<[*ɛJB[ +UIX'2;L+QܢvW@5.:9b_evt=S#2 |k3h\<9d蔔t\K =Y̽m(l;?LpL0Rk3hi>g&ydX<󩕆o/t|/i&vyבy>6 ^'46Ps3eI7z L}ƐD* H ["Ӌf93a Ϯ6~04Cq&{G7/3a/n6g{cb <vW)$l%v|Zb7$V&y֝&#ɫҷZW̘^urs$LS/ r"$G[b헻}Dy ͨk$'ِ{fflnW~Շ"x!Qy1zDOwd~*И/1ޘ%Qሄ^|RZ.?`J endstream endobj 223 0 obj << /ProcSet [/PDF /Text /ImageB ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /XObject << /Im8 224 0 R >> /ExtGState << /GS1 12 0 R >> /ColorSpace << /Cs14 225 0 R >> >> endobj 226 0 obj << /FunctionType 0 /Domain [0 1] /Range [0 1 0 1 0 1 0 1] /BitsPerSample 8 /Size [255] /Length 397 /Filter /FlateDecode >> stream Hˮl۶ɶm۶m۶];1 nCІ1 o1l0m&_3Ll0LmӚf0l0m[,n KZҖ,o+ZVլn kZֱo6ln [ֶlo;vn{:qG:юq':NqӜ g:q.q\ Wծq\7nqwqz< OzӞ</z^׼ oz>| _׾|?~ endstream endobj 225 0 obj [/Separation /Black /DeviceCMYK 226 0 R] endobj 228 0 obj << /Length 4586 /Filter /FlateDecode >> stream HWێۺ>N ۑ|W$E.E$慖hITIʎg?ԵIJUmmWOfuzʝn0N8=GZ5PVA]UO/d.C-2爪S^AWha,J _xʊb(@:/o|2(Ζ8*H1E:` K -.փHqiܛDmyFe"m>H*=r TU[RVͲ-T0#e[')Ng4ztJQ:(*w.Esc1E>Z. кWeX_e`HaޠB%* 0Ġ-ݙ(^9a&Pr}UC.^pݐ~&jS,EC8 e]`l/*ŀ< B &$^FQ)zaԳDHӼCq8ϖN}uK~Ĉr7y6>O M?n ^!xFNv"ZAz7P;ܟ0n6R>jV#Xxs+x/"*Etk*fd(\SOptfClD:l£_{{"v {*"Z)t BD79jsqP2 >`!X9]X=#-b:yF;-z`"8Wr'a2! Y~p=EFw|&o|9pGc8HӺJ 3=gv<&j-ϕ./;D #[]=yz4t 镲 a#–tt G%"rZ(RVҺsg~+X,;t?a4eMqG߀ՁR`C|i7 \ވs m !؈r:>ЭcB`_d͝ǽ^- 1Aɦ;N r_ɩx,kZSlHeY[ }=@Ù܂6h5Tƹ_画܉s "$7rx/r⇥=+3?Vɟo}~bf&s5:JC@[y#Nv qW*D4&$g0U#W{t+2,s&m U[ŷC7QL`w卦+$hpMVUPV~& De$R#Ӛ\4VvA`U \vaD4ցm?^ I$IبV2YMv!p~1z.Nq-{d+Bc@^}\b2-y^ ڜ\<ݿ ;7כ̵6pX]@9fhX0<ݿo?^n2Y߬8smKOB5"~Il!{֔yP/~-X+ϊ>l 1kS< ͖kn. {Ȥ3,.|AUvc+LeNw_:Y"Яl^jr2'?蘮ivX1O_ƙޅN# -wEP8FnOJѿPWQh^J -/@B;u !>Ks:0{۵rYnAh{:V\DwbPU7vG]zgGlUD(1,D^#*NӀ=n!9E煳ivF-$JYب" %^:P^qiiA> zyZ4X}\jG`#OIHL wS'@NcqwƒO.bg&PhV;߰ # <_em#~AKU-iUEM.&GԔVl9!-X$k|l,ެRvX*9v9B(bG)mXk ىFAk賫,tǧnc}[idEhz3*}8xV4'5O~ǝaJ@ehd)!. "X2Y&01%.96 IrpN!aH7;1߇ED]+lM;Ιޙo,AE7rڬU ** xc vȒ>,#T|  X\dtȋ5'EVy"X} m|Et~I\ 7/LuSZ i VwE9uh8`&y>SeJ$W,슆C /~> ) L9?x "FO"ӓ+ N/ѱEU ꬉ(?>V$e8Qod.>X`ɨ>]g[I?KxI {wM7b&A/TEC㤈r"w~>_,`$UnwzoWz5X2ĝiܱ'Ġ^ t<Y@#NLi_%=z' TJhj *?d1SDʈp>h:/XVM7Rbd9-j'~. bSTr]~,̀oۺr' w::uK&01z&ka8+iWjUNhmi~ҁJ@jʣrӮuQ stA>OK`9:I^,x LKl/9thNyZA񸭸{\Z@:9aDLQ:XoZaӊ-]<аN#a櫮aAG|aa؁fUnl.NETj Ҡ/9H{+MeQY/%=8V!!lZ|Ee D~?] *2v";"MN{[TbYWmX^ OT|cۙko7l*{j=}i|AIoj0]?jNjPMaqa2-?,=gRɑdR`Gϓ)οXI'ap1r!ifCs48czNbu'P=uVXqn?DV)<ި!(/62hݪJ:übK$or1"b@1Z^-CetɈ^7Y#IࠣP^Ng`xɀ;J|c?A}5"4]Ŗ4ŪU4V G#ļQsǁޮwiax1 qupC~~XGQ'Hver+m@>U V190=LX4`Bs( 8b+Ă`65NCr#+>פ7FVfX<{+((5uǀdMqv1f8BIR?_,h-`!{G3^ڐB_+k26XpdC[ʼ ,K@FEe_ɑ^:%q>FU[߅r bҲ@q|s2<蔻Ò`bA1X.! Oc&+`PYD.)ȴa_ endstream endobj 229 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 231 0 obj << /Length 4881 /Filter /FlateDecode >> stream HWrF<[$ [(-[ZkE˟PN nYO[yL==O>n} `[2㿌E%K[aoU3}fa^W)o^|p6[X67C{CR3޶=n]cp0 q BW[xϻX'[q6X+v8[ }?4Ѽ R2 (\hN5VPnE-1uG5KWĒbZ7n aCnB[ֺ9%;V Պ]>:G- sKe+qё_;rO\?j/W,K,^{(x y'fm[#\1YhS Aj:;={1`)J(oY4ѪcϥM .I_5U+*-;SbJZJڰ؊0ޞ8J%}vET- UʊWe~!]aN)6e<ȃB YWsvK~Ԇ.jz!S.ne\o,F3mjN%s,F+ jStZ%T}$ׯl'N8\ r"$q@ .adTAt*ΈͤwҊoFRKnc~-'xwAE譼#R8P(K0 _CWaEr% `8BS 6iM\8 徒; k oFk0J&T.-z J(E5@ܒJ[L>]5NqEN\ԐfFYQQ 6-+k%ng%Gb+9ŵUދNS/)kS7G (tPԊo#tul1McDaj9*I_ƮLJ9,MilkHFU an 8) mm*m}<6vI2G[BC26FR n^*xKm@^`>d _WfQRB@ zێ64.ʦV-?*HC7v"w([?R ö̉ϚD|$ӡx$X~S{7sK SÁs/TK?R-`8749K,#fZNrɆݢiY7iHcBÍL<;K. 3G3V UijxʻQ%> zNĔ7hPj2AlJV uF:tkW;wERnX8KzOTGMY %jD)[B/I9i_?t?~d?󋏟/&V2M66\f3@ +1NcD)>LUO6ig腖ߩى%caGC.^CQўёZa٠f;9o/tPε1D(ѴD4u+Mv-pq2qWG}oXo vzcy/6̦+n7?pLZө^Lox/sGv1xB 2MzYu}5\nf'^q7FzcEq|Q컕>\K/M/\3re> i8.̘)rʢ$1+kR#͌JWv,wxdXďLGD΅iq{슼xpcN c, rR2uN6rltr+sk-mT1j?Fg s;L#@Df`MrIb>Zo&ݵn";7sS8Cp:H\ǾfM׳'8@O*vj9h "iЁ] FDc=1>Lkk6f@8@ei>w Ĺ&P8K& y5Gla-n_ņh-B1t\QXgϯZЖ*ź #ohı4eBTXK?0&raH U(7pa`NIW gG\fj ԗ%CW,[6iRkg,ld=,$^LEeyѪXԻvrzr0VQQ6R--'P"FnOͩ%T 4fxԩ 6PJK36ItoKsv%B'3VO<q^.;I.e@"ih ]PdJM19|\:I2*5Yv\?Jם|܎+-nt/܄oF:Ib^88v᜔ 84-[sgfOKhApuv&G/{Ѡ 6D t,DƊ{DZl}31zsW4Pf7)v?z~%'umǎDuӣ8|ܹI0Kf#GŊcI< LTcN?$K}C,Xri?JK3s\'pasw988N*}`KTgE3`k}Ǫ7mXule&yry CmGrzYb7SRkܤ7FcjxA9u?n:?+ f+V &.n Fyh>:Y~ph@St{tTg-vLAbBT \Z}H>| -9&=IQb"%F?OR +aq죩\UЎ~ˊhD%9G73jxI1T G@zB/{uSv[{B.08Dlqq[ۯ/32A ) |SΒu̠G=#$X0,C1ݺ5]#SVi&YQeSfhU*Y,5uo n&sU^T>T&цm( 'X~g<3I\x}=~N렸 d%@jMƲA',4=Ϟ/siilN"_t1᎖= o3l A5bzBxbcLAwCITD)nŨ|?T/ZBb5ea`>r)?%`8c9DOW_i6ۻEJMD /@; 4f7::_p1R=sxLlB%ǧ|Bq9BU@~N!@Xd ܩH/$?r`Hk4v^$џZ38Nm?sѲC`:^wnxS%!Y1pԈOJOp6?6+[nנ~[gI=u_w9tM誢͢0{jLӖ|cHN n(nu6F#{,3m#Q}1:n $Y dW\ه+iRLFR8l EU"O֒VW9vII([Ύ2:P9E~=؉^he?:t)宦w zQ)hRUhz$ p,]C\\0̥Ku}ύ&^S#)WmgBX6_ȹB)_  ZlĊ!L}Ssɶ~gշxbi> (x:v8*)jkJ1-\XRRr./tCe+lDBu+;i^yoUO@yW:#f&<h/ܡ"2]Ov쟗i_Ūd͝(så:3%Ig!nO3 \iܮZAZ yZL}iE˪!Wvc?tf C-3w+;=8u~v?\H endstream endobj 232 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 234 0 obj << /Length 4608 /Filter /FlateDecode >> stream HWے۸<)}]GV%$"H+|[R@<\^StiZ߼|cM\XĎ>KqgÍכ>xld߬\u]|~Yx ʚeqEVx{왓,77y[yNoEg{IX!Y-;V x[V'x]IueuBnfzwX"Nysn[^}INˁAjF\blOF_<#QpADo0 癌 W ș;b!'F:8T]v1qG F;qpzKtb0y5[fP#-[ځLvOvŞ,"Qw--tl6΅F<9'Hӟ ̂j{ {FW<(vyd%Vzf+Ic4p]qbs{ۑ҂ }L [( k&aRR'vbGi6.J֫yC'S.I118 $WMfT*1fQ.(jU3Ȱ+P,˞0t P'zZ$ޑo L?Bhd7musx+T"REI 5jȩ%;b֧v++x#R^?Mʍ\lbe% tBOՖ<OƀgXjw4Y3E~$Ѧ8\da䍞@ތ^n(Үc]\|Ɨ "k2>wEܑ%9 r1Cɶw،K{H#dAOjE'ų^ q7eDZ4]h0AZr:"?pՑ ,8s<ϳ32oqr+}xWp%Ch2h@KUлG֥e" joKsxOo5ۍv%NB= ٘[d}WV %: \ku guzƚ͛Z mICo`lr-Ҹ#F;.{IgW~ufFI?|G@Ӓ\,3 ^s* ]H2UnͶ) WKx;X-2H_6D5p#=\p| h7P55wM  |'ڏJ ۛ?au'ƶoDžPLLo @y Wxwl'Y Xd9Hg%?X!!Ӏj:j^x3?4Wf<9$ێz` (rhjAmNAr7y.ۉ4L̤Ԉ0%ϲ/֡H+qF 7N0x)V8g?Xz.?+b'%4BǏ֟?[{X/?߮`v>A'Nyן沠XƎKdNEVUė1^-mA 8U$/drrrR%-"$"`0L~(3E9$ H] ֜b6\WA\8;[ardYHl6ݕj%ڣ}N.^7-oV9Ģ᫩/AC}};F6h;3YIͅb9Sdͪ~a@ _u7cABwRHuX9 L-oj3Ց~T)I $۩r;j7`JeJgBjjew#EDO|ZSWޜ^fHRH.AGeXjPfı#W"1PSSؙ,ݱb%y{ՃҠ8nmXW'Bm|/SEGz`p2XضΟ+|1{PnB[,*Ntl0>}Uv5WTU ^rWt3C p~w 7("x# 2:?1zNBvQ`iM'.ŏRi8(Z}J6,Q$=׵4p[fQgAoiRKS^N<]kTT| m$aE^Fe>7KL7kV>rK+}U_ޅX'X=lQ.yX%hRVe{2QX4{C|wd4;nnno'&eF[ᐚ> jlvc9Dȫ(<%YߐlǔЁ\)zmQt%Nٴ=x?Ū`Cui,AƄ.sXm6\L3y3Sb·\}x!bU)QJH:=Z;ǺUOwnG]loԄc:RD-xrtD|ͼ (n"؆<5ix`^%V*{zo6 ?OnZr䒿;_$t K&4S\pJc;7)b pbzZ  gyka uu/' X $ Bk3-$ ;)/ +XacSj'DZTSt͒keKLNTGa%^3#G TKv*yyթ /C{^A;&ru=@Sbu8;9?úQPS9۫N.4+0>ﴬl~AJ.mK02Y=~gڐV&4jeRa7ڂ#zt@J YENOEX*Z<.gJXl<&)nH؜!M߾҃mxpn?pg> wKr|*}g^5M#kci @k|+^Ж TkgJ_U% &W!`Pw6q3V*`k{G@}.$~xVz^hm]UɻקAݜVKlɛXHA*WF :VGIiK` ?nۗ|u 9' &8@mu'.݊ifC;;Rˋ>PJoLlK[_["18cz njĚOV' endstream endobj 235 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 237 0 obj << /Length 11237 /Filter /FlateDecode >> stream HWrMNX/އ]rb֕0X L~(g Vv..Attsz `[ooK(bY{l_Y? ض7r{Z xYfxobˎ fTîU{YE}lO6lj/RB/Ð^F)c/xkJްFu F]}bmv;8vB;nZ+YQ&!E& Gn;ݗ]x۪RNT6xMV?IVll:7[J  [m#;(}S=>" sً[21Dko#tPmE#4'q#y'cE]2T5vWY?CP+o\T7SB(j3}(Ýxc8ӤLuTtv LiS`+tt{{N5R1 WAZF=ڒ깻٢WK9@BlQ[;Ў~&vϫ9$A#VꁃJ҈ӣDyM=}EBhT-7d\vg9,j.(T[HNFFam)@̤K%;rĒFKc\Xn*@$iby0c.=3m{n|n=~DϩK`: C~`3QsB/Î0'2>Cןo7U24RAy\[JAlGkVqx?X#@t^~;vSgnj[Rlo)AZ^ReXLpwKt3דԩ/VƟa'Ec|rC3&[%^ JyZaɳ#ivםh:+s"gYҨX ¹֊v<ßW(Ptew=vfw -g--˰%m ]ҳvf% i'm⛼sKce$C_4[px80򊰘}Wtጇ)s>Q X -yNR/bJkv99L]Dl(0 gznTDR/O7@3Jvx輟 MjRGWLsf,W8P%`xIg=3(/H$~AC=Jʉ="馁43jh$a%RR)C7J&#u~v;qqߡ*æ#HoNY=?99}>ySkjׯ.h&۾}DD]I?UW'@@ӟ)f\Ԁ.fwAd~{wPrC߾E:ݿgzO5' Ρ&5Yþ~wp\#K1}Μ&1/頒OG$a轛㇣B 9g7l~O^ўp{yI W~ oPrsȾ~J\+^ݝ?[B/qqX W.XgLY^ȉƫe˃HDmѳ^fz&:Kx-ǝ_4bAOlo^Hh)1Բf"rΫySZAlJEd(2hr'i$~q/}L(IjcRL/=6<İwrgHH4bgZf~[NO3=#)R\9>)G7Գrtq~.zeCfmC5e c s5^f I_uvn79JIHE^mV*\3 =[PpJ<0Hb!)qda3 !#Ic-FcLr\FF4]2'D/2qHPDƫmx!l$ˡdv+$%S Z'r[cbz{FF{FG2$%3"6jkDu_N׬N,N;'ԷueʡQDGշ qB[DAq 41"e!\"˥?g*DKCd:DK! 1Mi=UŸt:Yv:YvK=YvK=YDvK,IpipDB :HguUg11*"8t"IgҥC @`,cZ}x5ʹvY'E'D6pP̹!A+ BAA#yFT"&@AA#A[@6zdO ;[cYd(OV&{L?iD/'8;D,O۰oo_Iď,\ȨtJ;LJ`VډߞUEDܲ*"辠/ڕ_ W}|U_HzI"AV}aBt_PNŶECPE30mT}a&:LV .d֪M/6ѱVMbK!{-tӧv}yip_굞zBx?^9~< Oܘ<%"ޠ3_^rW:l/O~=msLP>o^Ŝuѳ.+F(M.NB.wtQUŀTu[j:W^5ȶUljiLJSIvUo*"'rvGu4z9 -~CI Pՙb<;`^\[س fr*z@=>{P5(x?~%g X$3Kh6/qיGTŻ2s=|+6>{x֕f:-YPWߙ=5><1ŕ}rsEVȶ$NNKlZaA,eMo_Yح-ٜ.f|sVEŬY]={gvfewBgw9)~3^N_4e/<&s o%8rK"epHl dR! %Y.uB"3@Zgl*:{vŸ ?$R*5$1B35\[=` ͪLG=tt99@8x{E ,"AAtnKPIz"8EE(ci$Pī9(h=(hfh BNb$ #BH9N"ʣ4jgM)a4Z:jS!Av))#r B<┓EBF_-# tq6nڻ~^?Oܷq|Kŝ "j'~7^ܷ$b1MJG/JI`%@v*T-@gDzjR@* M5)`^TEYy!x͋$"^BRj^0\S$ zw-' \kQOҼ`٨ys^SW fZȚL4 ̋nER {C$U-tӧZΧ__^2GˋϿ|rI~PJ̧e$퇍+]rR2h|hb.2a/l/"ϟ~zoXd*5zK =N|[(Kzsb*H[CNHW^JCOtbۖ b%!HA%AJhoBJNXy5V@46W!hEM `X%C=%9ݞbg2OZԌDq+=FT[\2,Vs5m NGcMؓ`Ƞ)s_Xb+¼s#{m+r"#lr,=چsEsu1bFl]ފF=P+,6GJYӯhEhhyre0Fڈst[3n+IYX$qeɌ3598li:glNΊ聘UӃ5+t_R;K/}xw2ϨO߄< P* )ҧ{Br*IEyO{WO?U⮶>U(4T!?,),: t#}*gA'[gC(|CY9MBN2=TA$(:?@A5[8 :Gu ?fX JUgk>fC΢L⤳T!u^g;*k@.WX{E%BDՎ !zArV%Q7zKe< ^Т C%9|&d}@\BMHdĖWj'(i|?Twk1yȲ[}?ק^bU9(l8U}"j6i$/âf:aQmU Ś4'9TtVsqzClJ+@{ ik69+IsȺ9acgY#YG l':5c«N |wh|qf[oS~$a*<|rٱ&wnCL`9(:+H@y}2賿ײu1CA믏_``ozGo?c&o>|@8L8_,bߓɮC&o=e c;-l~I/oVp1Qd\)4X8D~P+"'2mjLji<>vdKST66Ǚ ˴e?m9~LeoJgEʩf2!XhDX kt1dNe@UKpZ>ei] "sWS" .wUS(>8)X_GxjkIODJ,@7%qTި;miZX/c-H(yGբj(1$ۍ$`3-;-&13^_,v)q*2Ld?ժf鵳>7r]YOI% qfQܯ_ V5Km** ڕAE7Z,v룉v+"}Ek*AL C.kjQ3ڙFPuMl1H_ V%V)K;UMFd|#RȢ#aTq&jLS;~Ԡ^ksIjw`0r'VEM'E}y?Pz~L:gW2NG&TAwW"^xA?:9~v[^DFs4U-rÁf ~r)ғF_^% Ϙh$uBƃU2դz%5@j\H HP b9vH `Z( Pur)NvJFy pXfkRx'\H1wWGfjYT; F_^U'qb/N.EӍz%`TKR98wJ|.0d^jh "KF{20[z1w6fiқ-DԐZ Ԅ_j >`*0gs$>ϟ=QyЬ:=p ε.EAO'-4%4.zuh ȧ땨C-^TF'~Q^D,ojhN'۽~z%5j)HA.E7JTn*? ʕ\'\.{;}z%hc$5, "a߽^ Fjé*'3ڪ=<^IEՉo[Pkȧ*+5٣y)٪e$(\~8{EaՈ&ԣA oiMu&SA̢ -:_40&b<yx S3B˙2BB{A.E [ŵ+)<:YA$'XE"y:;ȥ~߽^x}JS340wW".SK$)&<pw!ɄBrg(R{_^Ȭc.aA=>.8ġfXYլC2R$o+àF{zԂ r)__uNj7FGNFA-(nZ"&Ld?ժf鵳}x{0=DsbKmDK xv9Ipv% u蟼jXzml#k8A,G4cqLnl#;'A2I@ ?5YO(F,Հx.8LMa"V5K혠 prc_4Xϱ).v;hBN|C b5C /,m6RIUx)mFj+E[1[eS4Xj6u1l~l(9G4A.E 7 6mLeOPyp %9]bl'2o~'gz~p̿>qU d^ !Tu#Kr endstream endobj 238 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 240 0 obj << /Length 5337 /Filter /FlateDecode >> stream HWrۺ:> !H7La 1Dx@R>%J&#ZkOΉ>Rq$QLG_4t1!h^'`a8[| $rtZry-ϣ?P1ev&ngb?N)l0=}B~辏ף^hDpJ'EF N„;gEra5n/7Ъz.[B~w_@Ry6#i[/yuS~U6?a{^2!Щ(J-*(gsyU ?) )1G#@'.gOaFݷm|Tq8:Ct ,ZE6ak[L%ct^fު?$ blhϡTR"Vldd~߃_#}5?sEpE;[l[;Q5( 626&O{>QV.8M LW ?ypML0}5;s貕9G:s>璕<j?>r C\RGp5Yzy^13’*7}҃1( |?ju/ ;aR7lZ3ZM[m߾o97A/ 4 ^$E!#)Z`gB`28V%um"بFKCKU%ߐ*LGouY>S)]gjzG\π?@_PܬtLĆ^g2ZI"I / |"L(? Ӕ. GQЀ@ Hta B7+0:fՃfK @L}MbλBfK ݨ] )] h|18tkjzkŻP.4M/5Zj늑`Jv̰.߬ cP!0S5h048~qdgt\Vm" R[׹ >?pmi4z[SZ/'(t4i`M; j,Td C&e[̷ | Xir Jm 6qFLwfJZ;E䐂ty ްD bF0]:Am7%K ز23I!8 VAZQ]z0qUw9PCu{z-$한~i]J54QZs(Lo4 k=f STb!qVO\$ rfkG wZA@kA3Z 7z]ɲEk.E {4( u+FA|^/mज़Ȁh0 B_Fq^pDNU(DJ(f 0X%=P e0Y]5Q1$r>26]+%84!{jxt (<4{8VA ɂzfق,Yhkע\t%o* eSWC/WL0 * 懀Ƅ\W/h̜3~S?ߦ;t~3^Ɨu6+-f Q~߱NmeK%RORFlLb8_诨XN`ˬйWZI+T[*];8Z&@S(g;D~$nQ 4t|WJbv! ցJ CcͦWjΠo±[X"$-q$4츊W(kP+ %۰Xm /K8pbb=[h<' , ?Jx}qفggYXqsxd'p Pt7O 6ЂihЃ4x cwkv[_|pH&^%eQϴ" P&6.s+কkm9iGa O7UJbPJ¶332)M 0QNi^wk0 #?A?^, (5fjZCSgj*=_<ϊ9#+m o@a?Rupa0[ ~j8 Q7&X/6, ?AށKOD1wNT3 FmTQsgnG[qtf m[QB$*c6_D3 g__M%sX۽W4G'ؠO<ċ*w#[x=!x["ĭ[qD"8fYl._cVh7ש+m~tkCAdj%ۇ-v|SXp|/J;p%QCm҅V/:ꄵҋ7 r+,qid{E N>x=DQ&mH yaD^4KC>pڠ5dl 0ӎ}W=_ 3?jr wOn檐Q6nGhDEVwކz+0[S)󂨗%^I8quQO/GWmF5yɆ]}`x Y~`y~X}t.kAB}|a.[}&o6V_QU-}Yju+Þx)6#Mފ k,ߪ#~ÍM.^x Lc`WVIw_?b fsM 3_O΀]t;MkNGа6Ҥ}I:Pǎi K]YLA*/A[b<#C+~ro}H=_uy:J&Z525dDPy:GB~3/6D:3F3?7c,fy\*z%qe7x:NBkjDտdHStͩ3cާ6Lb$Wm =uO^-Un" u+24ޯ FЇB`9 *|H> k1l<>6wݵs\nȾ'LA[0Y.ikTe]Ӎv:[AlfL,3sRErnX>*`4n>?5tf|@ PS#xvc]Jߒ~y?$V{ب)2Ur!D=Хnb(pzO苷B<$:=I{:cA;xI|Ҭ]NR#+8M,x_HZ&nHRA`Ҕڸh?4Z6v) %6ptW"{u#Sz!s^$, EwNӹY?ܳz2Ae6XfWU}A}} ncr=$o1UfV%7z}WkQ&b΋ 9B<|$Vo@4te:KV%3LTb};0łGgt -6 A|wqQfQ`9 _8XjR2iƨfBm>RbH[(U}'@.&>4 .SE]\w6X,t՚ׯzB|.7f4oQa0@V_&8G\%Kj7mr.xݶnxREjg\N7szUdH>9t4!ˍHS\C O4 UYA%CA<>h4Cý.jn F}uZ ɋJCGe4@]4!rۜQƆ@93譃H T&JrՎ!ORXUPi#6Nu(pauUV Qt{#u@偶 !~^ykc-˂)Ileߨ5;6+h[Ҭs[EPqDo=%#1qfmɳ?j,ߙpTlU-hvdzIir.q#MQ$Da iz)qy麋{o9Nw_t>kqYMZ1:ѱI=r"^O8M *$HamdȢ'maG@qȎe;wT#Fu5,7'jֽ̗U.% ꏠJM`QN@M4Aln;wq=na5h X/$m^Զ HG66.KSm#M<= *O r]!q][npO?C Zgt*>:jcIGY/@H5YBtNAjgƷ8KJ\Z𵈍%W(_-JT5׆d35gvx"]yŝ9p7IukG?"Թi:3CyiQo[$;ңp?X5 ^\ endstream endobj 241 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 243 0 obj << /Length 1128 /Filter /FlateDecode >> stream HVn6DAL|XlFy4t E6R/Fc>,, m0xp٦i^Vuze} N 5Y-6g[lN)ԡqSA{-3j>j{+ \JLtR\x|^AY"5hQkתXb=B"ӺFz)1 Xw9:?ߺ¸c-۵yJ%rRf a,N(1h> 0a wBDLlRBA\AQbfuSV!mI2`6f{9v;9lVo25VVѽJ?qHfSraaĺ`oѫS2Yry sW1W˶F*?(/i s`=pFQ"`ޖZri>_UߊAVCuqhm,TèEቆa|)N bkVD=]!>㝞}7˭qٺ0И-_w1pMZZ- J?U;;V2 M5)Z %do5VBw\xA:syB^Bbq@^cE&杴" !{1w }DOSF[=fiv$р!j4Ū5Ԝx`ry[i1T N^)*'ZE}n(vJۅ> ( du`LxL!2K=L⢂>> /ExtGState << /GS1 12 0 R >> >> endobj 246 0 obj << /Length 4476 /Filter /FlateDecode >> stream HW[۸]AvCk?ljNY? pR+K|d?9DIM,J}s_% Kd1J%y.W)[Q/W쾻o {&a{sGqoǛiE}$|SofY+ak՛}Fp]5h׫-(Š TX߲1WBgX`yZDYYfTϣt6BF;fc.h爒UY̢.ʗѶ[^}Ah#퉩jys"),Ҩ\%K*K޽{}yFeɚeToq$>W܈}J\jan.{o8y$eKZz2\eҰmeVN0TYqzml=mzNb&ъ -xDCDر>kZK8$E_V[vaGՉmT []ޖBje5,B@ w2=g&L BWb8?\.}ާ=Pv)Uw 7LMrb" [(UGh>zIjbt 8nk܎VK4³'Mʖ >rmF*M+ t;bEMCUߞ( h4nxe!cZ R45wFe3JgR璂D灁IMYr6ǵM1<4jγ"K3ϥcdQO4fF2.SI*=ġ1)qzS/#NˀNj v2&Zm{'2d"8k6|jN`RAp yĒ'\: NZ 8N&,VE hr+.$|hn~u,܎rwj6u(z,4\ G=n5Dam/ͼF r>O@xPug؎' }ޱ. u9aQ\e{յ\-</g 6󎠑U㇎UB3A1Vdb$tќTѮ "=k#E_rlJ jlV8ծZSasM"?2t-ttL^U/gFܹ>Ay{opD.MA9i >Z[POÀbZ;Y)gB{ \Ob{N-}52GEh#f(&ϋdz0Y];ΦgL,\$3Gg,3U2W=$F3u(|.fVΫ08 ɠPB<T95@{e_08?gBhV+(k`٬놞;@]'/#ՖƌyZd=`PzqE;N-On-Uc@yCeӛ{ƁtG(ۣ 2`=Vk9g4:h#Zk-,# CߝavLi9(,3 x)f(jKׂ&0fH O׳ẗ#&EPk F\; 1ذY:o9n<{wPbnf|IFC hRSE(*~kdm{vOMV@u5Kҡ8hIH]zPv2a 0tU'ig2b&>$&"i ? OI/E[B[C;(H!R< 9o oBqHt+3Y(ʔ5bl~m>݇w^e>a>a>JdǺdkt(]@'A\Ioj+@w f/:De>IhZ(z$mXxT$#he++e,]8!5$1.|LQ-rlrHIvD z[{8J+L!ĔU/kj~qzk"?fwt%k\hԵ-fga"nY2AfBe&L@=68k.َ0;OĮ ڒ.c`fjS5<[; `qٶk+9z̓JS [%Eg80)PMw 1YX~WmIÔ >3T s40OɄ9܃"&n%e%ci,Wc זBB.?~lǜ ,,!S UXe%o?9C?L#,jW'sko<Դ,pbW+<_dFT-Vn'^D6u4z WY[ b4< P^xZ5c#MxѾ0ܩ t|$أʼnW*3u^ē+ x,ޓ=$p^Ӕ*=2`'&q-5:QQnڂp/UuMn  HOySx"{mkt:kov󥦧;[z=PlSz׺2X"0fh&3h> /ExtGState << /GS1 12 0 R >> >> endobj 249 0 obj << /Length 4649 /Filter /FlateDecode >> stream HWێ;I%y·YEFXEDH$G_ ?9UՔHy vaGSNi}]H7+⿕JVAfj,Y'j]߄Y7?Dj7. 0͋x^?(b(`/ppCaMtSmՑb!v|M$<|A卺7 u}EZKΝr\r[n[3|vZ.]!B gLҘO7vq+k_ơ~,٩v}WNKQtVfG?S]%__*\j:ض5m[چ hͣn)/ Q*Lc]:2lrooձ ʬPC9{ln}b"mIB Va$|<`2|׌0)EG4A=U$P瞠|PZHʴi2#hvy/XENu*[iE#2Wv\Z=n7A%A&.QS" '=ԧЁK0[ybG[=R!ŭH\ #V'+U0` <"=ڭupт9rwD0<Wr%JٖPU8 US\ Ժ jF7ىAnPb0tV( ]VP{cpʙuAswmcJ!CBITtOE!昔9\Fݫd+3:?QwԮr1h[Rg01&6`jz,ildf"fX` {in^ 2iGK))phטBP!C+E~[M7\ hզ*θLv;8]Bt_G5]osH&uU=B)eQGf DuQzGީk(<he> #2Y҃s6sV06w839|dV=B80drD&Ӧx= GXfT`%q,,yH%#gMLy1L &~!/0B:EDO(8V,ܶgGe=zk䘜Wf{2ܘ6^w΄Mz*ʴ 8' |3;(S 6I{vmO+Gal oJEGj5 {i,O $`xZ^/FzN &swgoGWsδxh-w;Z Vla $=6ö%GiWdwe&L.YpsXi]''.%k 2[bz,*I`$&IrGL (v|Ԁbnp6ދWy:x })'Ք'vmE߁;!-!3>HC._@q9r@N/"HD- Eb?q^hA9rF{>)ǧ~DLjaw!ZZ?dQ佞z<$si1(K0& U<œy[XrXYRҌK_tR vG6^&Ѝ4\\l%3m o?ue8?D{Ad,6"&Z$$m $N;>'ٰ2h[,5 0wY) 9h% yq*PYH9U\g[X~0~=3%/@h鞞FaAC`\*/[8:[êrV/KޠT.oG)bTYHTMf{#7ZFBp-r-֚"oGw.MVcH"}9VN8*Q'~n1f &$BZ 8zf5J{BV (Z"80wr,j{5F/:I<2L̡- ?uK/[29PtiWaf5[zc9RY9(5 ~Hb u]<JG49BNQk1Ļ{s;7|ijtݐmrôEtm|H7ưʱ TnH5W$Х$xJ/( d${tz9u)OdO/:>v iڶJ 䖸DFJ ! JVZ˕Vd~OB6te}fҒm]+vz1R*!>;{{#~ P)vIPB8j5"+ڠ(guEvbmw,eI]{ u!CmI$@9O9Z / $IXTEVw~\E^}٬r;7N4jsSf6hc w1H/(?.帟 =SenTᶷd_HY*`Xq`{TQϞeŧL:Oc0{7%~ו&%&' a528^>,] Pr׍uلp;kٵ>nW)1R@SɫwI֍l5k{K/2mHi7/>"}5_Ln/bNa#+MM؂n99h^-LgfiJB*2gb><~f6lLozr-7k{WpeSc /ʺ>J-N?ض]s퇫Vɻ i)M=Xx9 [ M˶~TAdx0e`(xZ{.ΕuAtEImI9M=Fa2mEUܮ/'wЏ7EN"%s/˵&8~zvQG8m1%0ꮟ0> /ExtGState << /GS1 12 0 R >> >> endobj 252 0 obj << /Length 4422 /Filter /FlateDecode >> stream HWے<Φ$.IYfMNʞ(d{<,[ ̳<u̞о~VS 0 }Jh&{ԉ cհϪ# ߰7Oɑ;9*x]$8[}^/86*w95- ak1jTwצ=|ꢣ`J։W v=P$mAaԎDrcD7ث>i,5Hg%]%jrr$Nl?, yGfک}6ey;C $3P)G4GZ~wԗQT7(P6gs&S/0cBDWt(0Jz}: Ў '_e Y`;ߠmch;BG8HydwNY`a *::NĶI-sr(պx5a\HCOWko:(^;{F,cF?azeWfnU|$6nw1+rn F^}_ɩ{Q DGN|.l M3rݸ?֙)͛eo(i4ja0ZPEATb=M-/c>ƫ@6KPhxuxG=?"/+a)AU@*>i'b y0VW; ~n; 5%ꊹ(r_}Ot<00܆-:jGqŦf1],6£yAFz~=OoVKu%vǷ:ںͨ:g ԛkE=M ' dyf=;I|Ni5rGlrWb9#:gǕ.`žN\ize_e bЈ展a+eXkt98PCQ|*Zq;yM?m$+%tъEuya~cb.a{o#ug?,`H([~~x~C&=KO"ᡅ\ 0CYrYb`pMiagRN>89SW.\Bt 0dKsl]|j[Hg>$s6BmY;tq)^5_mJ$% @\mzz:,:uk_'Nu)U3Jt D94ҳgkE櫞oǾS H4 Iۢ͘y,'0&yftG;}PR'75XI ܲQ7ww|GzcEE-[N_4v#(i$SvC˂=fNV 7& dn5MIGqL"t/'O$  j]ިD#x qε9e%W (7pNɩ5:Z*cK>5rq N?QK6Y{+&6`/>R|WqS<Hlcn8@9y!dT8ttx^8m3AGTesS)4K:g;Է&t:$^[B٣Lwj:`C(@/on㎉ibv*n<]xk ":Nf#W񊇢`Y$>.W*OP 8Ɔ'G^%E|\~r*8EWTs\7p;HL 8}ɵ3(^GxmvFMRkSZN3Ne߽xLFD2/F? JeQ0sKr3ދE=)~1j tNsCƝ%\Ƌ@&wHͧq' <ּ&Zew"w44nkQV-Jme]cKUSa$ /G1&ekjd1,cj=\-|v8,90q&wEsm +(;>xGV=Mklfafml/U S cňHG{޸FO?ɰ_@!Xm#:纱XJ< .V.p|\`A|&|3[LvM2cwVqP*=ŐQq-sg(U-%b(ˆKqt'5*HG~CjoY9'Z?JT==\6bc`<ðNĩ&H4G:*U4jTE @М! MiY-[CQ$E|R[ɭ3qwq+ :a?!pV?8>FSض߶i 7S"*/Wzz]51V}.Tq2 Ox=Ń>0H&暠wz]%~U?5 HK=w,|G(`^ֺg%^2l8^>*2VJƭxQU𚶛GӺ..|u9]Ht^:ѥ,7K8b(C n;.Z+yLro,*+ eOǶjdwpo1 .q=P1|{ЪhCqk/_>2Vzp^{(XЋ"`A:^vY- hc.梅'ѽ7S8Zջ%Ioi#MUBҼ9qA]k0}aT{8f7ב|RΫ,Gmɟf!303Hql;+&OAS%xYYGÉ_Zc USd|_$ endstream endobj 253 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 256 0 obj << /Length 4037 /Filter /FlateDecode >> stream HW])4II>)/E@>ȑ8^p+3?AOϽ3( 1y~s=[ E}$,Nj}x6 Uj?GI1Mwn9pZ:%uԦ8NJ5b Yv;bSEug0sJGY[yTqp$b~!G6dK>)>Iv>VNJX9*>"毓RJ(s81v~Q\/ץlG,+X;> 3ҡBuUQ=( =x?RjI_j]Bc#-'y9mtߣB7S70+KG)ŋD/G_1H%ǥ87G=0{%G+],5*%QkdM#*Fx}C^=tHR6~P jZ iN}u –|%`"1GԫM&6 >D"J]1':3ЈَmOV`S[T>e5;N@9T"Z0;}OX/]f5 9Qo]P߽fiXLI҉l٭Dd Sj32ST" ӥм8>|?DuU\tk[䡮0Nm[?a8u W@VW-Brs^\6Q^{7zlչq>!:%DI[1If<s[7UmLs[D!n6PƜ.8 7; 9 QÉj ybbFt U3xuh^'&}.,Tb;qӽ&ݥ?1&IO-'@q%Hoi-4$eH&${2ONٜdI7g=.fSHr-ZJrziM( f՟9L-[ J(/y=;Plxzc?/7z#60xAa2>yy,Ls&7[xnZb(1`]M>(J1JfFd ؗOo1Sٞ[wmƒ}7IP;ZN8D֙w ?ԡ'Cn >!,:?6PM /hn"q`52mPcbkuwYi* {K5Z*5a2rd.ZY񲿈]@}=dVhN1 tyXUq=ŽT| 6ھtﲭTFZ{I~vNHB jKG e]µźv/=li@C]Ĉ2قQ LG=,PKa`o\? &mD\B=EBER,1,J%,5^Fzpu%H_C8,u?pdy|tMD].?b~Flaa63Z hb\dnz[{g7"3L0kVo#Ynn4<8hr,_pw1$GfYCe hoN %7Ѣn=APU`r |?MѷG<"<'ë́&5ݥ {a;˹BĨ@ۥ˙`58vl~šX-@^9D [:af/KEoe".8ƕc_qO`|L,6fx z-DK)78_,Li\Qw\vtCe7 ևj͕g#[Dd,?c2B܊ZuWgs1x 7}iټtP7j fΫ$q#Ȋ%kbvi$ h4YȢ6eɅ 9U Z ?#Cv$X DՔquRJQm^C纨ښoR4LGb MRC:E"IbM_nֺ!sgXcJAH$b9p%'HR˂=LZ7ILBon/đ}w J6(YO"z@]jy嶖Yǎlka[#gGLpSzC ^m6g(xtxƒA*ߝLvH4^r*jLHF٪ar?D39qGRQEDUۮ)-hOtі]r ,7{;QoEHO*FaV~ LiyVu]x&l9B_sd %f)f͕s<*og>)7P("PCV U x B0( 8a-رcPO6&_=zF_X0/%צ?2\4qHnux$iїufi&jnIHiTzxL]u8{n_MB6_ς:\ompe 'xLv #w)mȮR>G]a .6sOﱘ(Ag:̨)=aNNE1_7~F'$ \dtZ-—y{S%Y;XoZ4UC<9uůq2Ц~(QQ՛[6螨py`;S|7mWc:.Q%;Ox\@_ b<<7˱\8uh'b0W(>6_!@BګʛoZ2# d`&tUKS/ D0곥<7kH]:;T a\%:S˔(!d aMxs'6' nķ*m  6ce5W:KkG2ztPVAb46?6sUTxW(~x|ܰVOy.ow ˘=hGFՇ)ϧ(jlQ-c[1܇7L>w۲:zY,nHp}NP m4]:ռD4⺳TQ;\`'dBP7$ҧ{lj "Z4 dFA%53bǮ\LU0`0{O \*Kd6f޾X)p R&:d9> GNȯ|mȋ|OᵞwzZB;1"@t`^ڿɫ& j4mAiÿ I,Ķ endstream endobj 257 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 259 0 obj << /Length 4267 /Filter /FlateDecode >> stream HWrIlYJ7wSڈZ3 T25ogL=vfٔZ7w輲Ѵw]~@]\n42[w$1u/:,bMF0>9O?J[.p!=rr3bŁsW6ʇ1:Lٕ&o`.ܹKh4 tڶ+0 ބP_1\Ǵҭ=*6e]1wsQS8O5Cd\iy}o+پҵTc i#/x_L1` VZ6~/ɂ')T.>4ї )@j¾:U^:} TO6ح-m;p@=;!tJ9;da]oOt<պiĈtiM?[/ sQm G̟t8 2-a]T1 CaBko(]H`hA'rjT7ݕ(j5:jx$ 3zI(R=(tlGmY uj%`9gD7sP FlTh6>cZv:[%IndP I>F {T LXv 45b]0}e( ̀z7:ǤI;`D2oѴ1g' aIJKo;*k$|;u9;2#~rrN!+f.V[kyH&`9S>R%uR6r!„7|EљȬ/[u?r&fEg݇ mpQLb0Iؽbh|F$6}N ٤ 2>Փ:Nj<\ 5W IJsyf̱]yB'ӏ"O/?#PX:D3+yQ;yJ.вֲ' 86P$ѳ}2ՁMv֡0rw CxҚ5.79{bO$Z+ h3)]~/Ώ"3DZ6ٔxbFԸDj`=z %<>x}MC)4!c}ێ,#N}*,>;P ^ia i|6z٠a-rR ?W+?eh8Vz>):!xj:Yh5SqNF BXq'wƑJc@s'^>MFQe;CM'B( ͳ Քl WzʜZw( - P[cdoMmpX&Onސ Ffkq2_ڊQ̌\d#?&L[DQ _ mzٮlk['{oWʞFUp ktdW\+6(iyd-јp/Y},XL_/aü4)[>?fE;PDk{IfRkJ3 0F:Z^n] 7qP{h{S*/q_\-fyIx.+ !; aEU#UT4rɐ1ZǶ^ " vkW[ON[aǛKVa7!N/V}Eun|tFAKhQ2!ۃ܈^s- TMӵ|kb ] *28jYEB;u8(4I/-dw-9?E>4%p]~;o^IR^0L/6t%cU۶DA) %9zhAÒ\I[\KFQfR\9*zprvGKrKT^AƵyN諬apEkh/NId[we9G\ b~u'Fњ FTa%q1N?ٗ?_8T)x ѯ 2PyWE@y>"o"~RuC8+vFF,5yQm$Jî)PeIV٨2xP-<^Cdf *Z,~VX̌;o{KXuҰYz7f瑛aF]D8qHK Z(98h ^LRJwj~pp̬̏]a==s:?iK#`tcl߯6}\y{:}0Ho|{s?7W-ތ||wzd( 2]+vZ]1Su `/% =~+te׻aΣUl qD"MQ,#lU 'ʱ0ݣ|`O>t5TaO]7Nf5d5 `aI lCd7wFH0HPȵ-$,^i^^AtoPNf{wEoY_jjJ_ąˑ=_fw`Ao sd"ܸelt%R*NSKi[\ViE k[5, ?c@>Cy9>4AD>3z b[odfL-^5G*.uBHH]SLKvm ATWVP:\߳o]d u"”_,S,h sosW[t JxV(-MfU=_üɹaM+{ N[PPB|u nhTv^[q7U Ob-AJgCeh6 ,x"VUrIP X ?\p55*0XEZ-f0UD-R#|uŦ!Z0[tE0R]fcHc Ë=Y'/vK:6e_dەûiu:-BT0%d<0AMd'^T +B.&׮JM.royzT(llR^^y'⵸>}/҂gNo+'RS,7@,nTexkO7vՍc)wSBPaς|kԳe3Ya78h!Z]gtdFY- aLȕG T 7h-vɵ \)lc #w32hC|ӿ mN endstream endobj 260 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 262 0 obj << /Length 4659 /Filter /FlateDecode >> stream HWM۸p8%Ѥ$:N쭚I!"!Ippd_&n5c\s^$"\&dfF<6w1w8:ݯWx,be6Ë?TF9!R<n9e\,(lwtd,-kYBNj+A8S8XӈfVnZU1^l+68+zRV֓l{Q!GV+5B5oU4H_6ZyV)1LO#O(M`(01_Clj-$l=RQ{*&8<+PC!py/ @zGk &^!E;RPz5א$]4ܣcwSpʒV/f" /܍o6gkkA/65p*KC b.YseBBkgII;NH&h9& fNك*q_\{ǿ-W8sSIvw(DZvY(<.0=uЄ n0{۽ l7V qZ>Vjwm0dM3-j/^,1,}gk'R'*MۢBb qPSZ\1fN7*u^2:O1$mUQY.jɡJLŅi45r#CD՞bؓYXy04%zsIi # KJT^\Vb9 2c;hW.D̼ vFUqy3kϔ"{#0øx|BGnJn bgƠ{DQcbZaisχ\ZoF!\4YV&LW Tix@n9n;p :6$43 =o W T}@NP}'˥!i;sɶK@0\- sl{ {! s7j %qd#X &H3ԮGn{vړ\'j7S Ib(񾼶n г!:hf4g6^'H4> Ql͂`dY%ܱD[HuF7]v+m/jE,A>HTb ÎYn$ݥgv$:9yR[ f.pD ŜkC37A ms*u~EM~{(lyGaL+c](X&d e`LJ7|;*هEIVhul4 xFܺLc$(d h[ok"Nʇ/'fK*,iѪ0uЌ6J](:4NR Sbõ_70B%WyBp8 p+fS,7K&9zAGDZ'A/E 9kB,s3ϤW,lZB)Edh&F;9f7_F*B)d΁6"iڃı𴜵J#Ynjv GBۣa-LN,W15CerpTD'hwCIZJff 7 >dĄ͍4O#(zuXYMa; :⢄hBo>v.*]Y9eGieO۔Q~ȏ#YQy$4,W~oxMj.hi4AoMCQ̝5m(g#=&1>R<3F;*74X^ D`LjLB90qx[}QuL_$ִ)V,m۲`{DHvܩRw bK"[,S}-cJdco@0l.$g b2LKJ=,RXKBU6WLb_6:b~yKGzڬGg'0e.4mʖ%\(ZL7+L2ADX;,rQɪ}t]SkY|q!ٖ87ms(2ܵQglNJYʞ]NAٍ|Y[[@Rv ;Иrz5bP|Umw"#!rF6V+^0§1/Wkl-K7DTHT(`Rl݁ D &[bxү7r$1y~<u|˒ D:C)`x?O KWP$K hmIYY{&tuYF{{izIdﭱ([742 ߷;&‚e`H=y1P[S#=>}͠;\]Ն ~PNɒ"ykQJTMc3Tؖe\uS5A QQ,͸F"?¬N5 KvM Vv)0+;a'u[3|rH8t1`3􅹿1&L Ã~ )bPL#)tVͅ]آ)i%#֦ 7lx ׆DIPdB#RtϴB-)H,SZܠ|xsIYm/xk;?><=K.zFXˉʂܗYӵ|ĭT mg`LW+/9 \~b)w17v%hS[e!*ۖ@}0U g/BGAP]X`s]Jki9!:-S8SC7,3'X :ͮ!T,$Xvu[玜†a{m pۜa#xÙ pt><$~V)FVhF[sJdY-](]޸Yȸʸ<nthؑ>Kyvcu\fzҽ^rȞ| ~q;| k}OS"yEN<=M]Û'G_Jcʁ%=+߮t%&cm e2 C_),N 4{{&%`-pϻ 5SdoF#k|Zf2gIBO({N=IP[C|8ǓYa9bOP?8@79rSO0we0L) C_o&>n\yjZG=w5E;3p2=IHw+;]OpPA h~4JsRFLeh^4$μԾl@Stqw?+0* endstream endobj 263 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 265 0 obj << /Length 4514 /Filter /FlateDecode >> stream HW[r8])gJb~,ϱTW&a AЊYL~ %RNVI$p{tq2/g2/BNf(pCt-3Bױ%|HƦa&9;H_1KH(C3ʪ =`dW1>ofKlED.\tv9?=0Ccˈ,OzS"%3Bqˊè'l1EF%_%K2dA A6 7#umvΜ`FabͅT0[9){[9BjR_ wXO̯{kxnxUC?oߍ~e" DỶHRg `װ7;eIS&!6 pzQrd#@$4).@'Q]O:!^VKzE}&b994N6T7)^;ŀr > ?qE5*$2 xح 98xJf7.2'S4K y7Q$7ȝDa0S4OL9hB=:ޮ3x]6pD -~ztEЬec%vQ{`}m匇Ti1;v;r"2B7QA!o{x IxiLЅhiiJ7 \':Aj~+P]J p? E]҄ ~ y KJU7g]X>ˆft]CA5HKѬIR]|*X\=IBq-ˊ 0f`~Jf@9cFSWʅW:$[ !8qI i uK34OfZ#w(8ۻ1E,a=anvHC5~jWaeU5B"i0hZ$ڥ,e\u sfFmo#)a& ]xi]0 StsڜڰaBwEP`&)Ѕ[zSx6Q!N.M:u# GֻWY>(75"spgW)z+s$lBUfIqMp'EȎ`{L9;.2P[.xBၡ OQdعPY'GHHQHOGA\MS88vU@˛\2ٙۿ+YԓIF'3)A{CU~S+DJi>eֈFlDkݽVm&H +jYml]KhRg-XG%hBFHF-k$.^kcR}cJ jj-tj}7i86ǟsעD]{T&IVC0ńj M&coSauf O&64oneYjQKV?AOyBcLvJ~4=?hh;Ay5~}V -l(Ze:Oş[!nuSŤ' ,x*6&"tҥS(sJW,9nØnl91?W[}WuvbFX{.l0y 3s7 b 5/ag]q3jf(Vl/722E=aL)Ìe[_!7"=8+Q:.c/58p mU؍Y00nVg2DH'uyU²KtB''BvbPTcr>Nv4"1 H[b0SWb7cIFRaR_C͡BWB&Ky-˨be}]m}h6xA4$(SOb&c<$R%'7^r4UdB>GS3+b4u='Eh-뇭a>bgADYvvYECuYrUΗ45^mo _'oLWc2B]z6ow}u?K; kr#O0<nPnV+QSRpz ;:t /h6\0FsO{SY qQ؈; ([|sUaIb@I'/ӟSsԦ CW&b#H t0#&D奮!]䀒}RАiWxCU~ 謶WZh3t":c79K1hӸ~x~^s/~ڌ.Lց5(Gp/dQ!jխġ 0A+ a턬e_фt:kkfQ0rIs%J/DE{ DIx AlpqpeqLv9wBv<7+Ww}azBٌ&6 H=OZ! k K;Gڑ1q|˼M,~%GؤZ6v*J! 1B$w+dQZR C=Zt YM;ڻ9z w]=nn ?a5!,Z"j&rֻ䏅&FQkt0OFPZu x,UH`WB/S0M?/2|lRʹh6MfC!gV2sJ\[)[QM^? 7й endstream endobj 266 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 268 0 obj << /Length 4800 /Filter /FlateDecode >> stream HWrۺCPMvnΙ8XmLB"bP ҊGN; Y9Cd ׵^ZL~y9ldǿii0R?آ7'le&~9~[l&+Y5>$ qkK{%œhrijصnL_˖}F6/PqKXt;+\`3lp=$mx8C*I’ fY6!n ]J a,u^UKFRbJIZїע^;wm, %<,{K[ZIL+Z )nG0@]N^/vWƽ,؆b™b0bTGLȻadoj=Jgܛ%<&Ω0umdD6}UJ=JiL4soDWz_Q=[)ZauLɾExj* \?bw5Ma/Rvj{>Z/ 3jUvΒş <\亮a [;SF|(drɂ2l)ঢ়m~9lMF9*L6M^nTJ$Kc;ϯG^g1P=rD()I`ߖ|ݷkml|ǣdV|W,?S ظtՖ^u6b+-( }DŊV=Y(r%PEÊqoWr *"۷F !dL>'լlrHxop$3"(&69F4ײF)F:&AI{#'/6$ar̜L" 5:d%iDFfqPNzG b @pĿOEtI 4#3/ȡ# Lٷ^1f]^J<3YvZ r4]ְc3U䏲C{ڿf@MiGBҲM7ݏ5Xj9 D7ԪJזc(;,~/ uٮꨅ(%X]ďy/ %TҪ˦O4x=T"K(eټ2#!7gwvu&n 3Hρcg@䏺HbWKh))ce!PV< Cŏ6DzIg,m7w7o/kv; x{{b_[q+}5OS "<8Nv hscFp9ԍtTÃt OX<){NltxLZ[Q5񒖈]|[C+ > C+EDP$c#sʌfy uZ@v=@dHp QD4/ Jt s}M&iXjeKՀYM!@—{z aG_?hZwXFPFYf6R 5iEeXOVi; KtklI:ey"hIvV X㏉\ KvF[3>s2ጺ:0@(d2?>/В"/wДqylnA#X֑-7Za>ꛍPگ{?o D9L;M(vN6+Hmѝ-mF/AƠt<)*]I 7lOIsq Mof _IcZ:C%>`=ZJHEY,g^?lIȏ:%dˣHJ 'Fzc[-||mni脱Ne4:)eU F8XY4QHѕQzB֙|`vCe+%-X.bLG?`hȍ` 1C kifA~+Eۚ(ҙ> HK*cRÑakfhK$hpbA/\y XIdGfa8f'c1 &bMF[V*ي6/TQ^nm#G~.* !qYj[]J!1fH}V^(w@+ʝ-3=}1Ymry1Bv~{ Ulﳩ>7Oh.'j4XL_vP`.fU t<#Mp $!KRqd>7a/?z?z>|z;G Z"È V U.2jhl 0>蕖l;_vF"[=T9`k] )4sf'_(Je⾞zZe83e{V06vwLOv$/z8J,ږ5!߈?;ԯV39XKvU'M{ִu$#X}:.33vP)\̾GbmM+w^C̐4PX@o_3rRb? ~ߍ8Cu$tOQxhԭŪEDۓ@d;LW ٦oDs@V yAA:{zV`rhvt}+ 2&,cgs- elJE g~4ji aB=`S1Z A\2IPQF1HH٣4`_kݑa+{FY.AvּTk3-v\?5:uvi9ƌ1u쯢ƋA}oTP|Y2Uqx?oo_4_mFl.i\c9c_aNǿ.Ru{QLC8UgM_f~%O"K$OӫRc)[* u0Gj8'b{ KH_ ة橚P,8] Y4%.EpFdض9Jۣ<>j\Z( 6.3}a.=I7NV;ÈBk8*Л nBn74~ZNt({UuOXCO~CL@IۥjecDp!?TEnCQcNi[9Wܙj Ҝ?p_kћ+NwgՎ(]%o*0K3cJJ( $q.7hq•tG6Vq,sص5 2x/VMQiR<KLm"W2WA{4 yQ$ :o܇@UwN ^!iK4E_d^aˍMŽw!=@AK,,Z!{VGKUq T@CA8v=vJO^9W5ؙAod77=`]N:e ݑ>|A2bR#Gn]׷BG9$o_߻09MBĵf ^Y֬T^D|jtƏ,vKm ŏ#?zÅReU(!0;ylbi+~ :\U(Lq{p7, p}.+ޗ۽D=w, 6W<[oI rc,}\hu86ܿb8wO&^D7Br: "+d:m (B_Ӳ`pz>͌.N3l&@83ݩyBn5:I/wG**I%MZyX珍q[o6ws\'%UuW+fJ%i`}UP7]v"3⬥-N 73xeO88Ucu\Nb2aNV!eB-XC#m.7MۋW~ܫж02t?~9 BzsfCJ1]?5{}URbQq}l<uYxhûar?/(R5DH_VFڡ([p,9|4{J"зTߛnDP(@~X /p Op^:[zf.*ye}{8UD=ֻv2(6A ZܵS`!:/E jѳ_PWMJgggS6Gfv]65p¿][(uDf.I3@DQ$D> R;\BW9\4 endstream endobj 269 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 271 0 obj << /Length 4192 /Filter /FlateDecode >> stream HWێ~ 4\/}E!9+n֓a1SNz{}mw _Œ"2YA1vw1bwo~71 0 kwc'O#{Y%{~#wrTqQ8`׻7,10/3A =F'GafO67ՀaoY X*M1mT$>QЉ!{8 c:"ߏx}\3nX#9[>04vIViA$9f­Z+ChsO_S( X6Yc3psWQ9jK5Hs^S[jFT:4s肶?Q0w5#oQNbxEҮ[PwCy柭v5\&"p P-%'TAg9q5N{ KTe5K7ӊ@y7ȣ{=eC:7T7@wIR|'}H kcת3Gh:@ZHI)PQaI*vbBz磲 HOơC+K/=Nj0S[OCHSʥaLiCEJբ+0>z1%u qZI)ÛF ۞_O+@=(xU?Yn*o֍sڃDL\%}&8z lJkm?=7kZ۠(Q/ΌV[*HSsiaYeÄT}:&tذrsZAֆ c ɦ(\'Ǐ00AuU"p:MkLס-OG6m#n;&H,<5/BLS1,B][ǁ%prrHb4 tDͲR2Q+Vuu8]h``pOuX-M5ReˑmOA TZ:hצ;^b"Ȣ(8Zj*BbJ0G8jTBe'#2=6mS"$w`< ‹,QN6g)4.3Ob8majA#3Wb/.U{+n|:ԨV;{2f$3FW=xQKgtۊcV4hwE5'C8H9qZz}(& ':9rPzM~ y]/+b<ȽqIM-\𔵳[qe\3G*o=qϝB\f)~ 8n Q`Η*G[cqZ% v4IWX}V^~bʋkr6$Lr1uM}t+ban/sZxz'p98hq{&_08(2ijcK<@4K0kPV۹GZ嘃i{Qr6@,eyC*7V[^gD!SNZ =i1Xq]#yV&rUI%yIGli  A$bR• \'<^&I2ɣiQŷ: !fк6 {_G58mF-/sm;&#HZWx넊^Vg!d ^QMK(r4̋^z ?U\Ne^+D$LM)4 UUǖ}4B~!~A29+L\ x=) \1$s'f 7V5F! ɦR(:N`O)yjvpiDjGa i @a+Lm='_;sӷROApN,ZnwC<{3+nrBfG+"QE!lhK0{*HsэhGW]sDjq&1v[Q}HG#Zޠ2eRmXN+RܐϹw%[JkY{?9&U#UNDTsst.+3D0ɇ 1A8Lj`6g'cD "Hj}]R&Ŕ,8>;In= ?`w@ /|S6$=]ds,J!5&H} hļ^b38R p%~04@4 G +1nѦ,ē N9_u}Ɔ@ "+!K/]0/y17*iڮz2w|lxp@Dpi:H HK^ć?Y*h.2Y :3 v1wš>2W81.`0VUKR8'4٢\%%bkVqz3!7aJ?]ZH@s az'Ä':‰ivx!#~S6 EeX< \" K|ǸRGpa~cFaR,\.`߹/s͑E3f|.j%CKRA!1$˗b pQ7RՆy4]ڰ_2g$LGrĖ'!?Ģ@zNVa\9)~`lBBE$s 4Tv #BjkTX`p mQZ!D6odB6vo6wVF`A҆.~'upO>J])uGq@㛵c:ʣM' DxĻ!=cB7RhNtYV}Z^/speE+i{vVVS;<Eyʚ+Q4 )mH[ּ">^f+zՇoJWՍYH ,(̆lpHVMiEO B_ 1&@l໰qwپwTV:Fg"T֞ ytY|Oz蠇O[[A ͣGVl28RRx`-AAq(vV10Ch ,moe E.jMk[(m^w^\eqI(+YƗm;^OjSDa{_(?_F(0ᔍJs_j 0@.gc5Xkt#>'%k -솗[oI[P endstream endobj 272 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F12 273 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 275 0 obj << /Length 4932 /Filter /FlateDecode >> stream HWnHytËH'A" yh-1ֲIi?lnR"I"asSUruGUB.%H K'p+YW㺮Ousz]s8WTM!5mTCm]VP55WNe6_jGS<\Z8@^ht"owo|wmhZu9D{K'^.MюK]6ENIjCT-mPs~]?S]'S4iYkX?ڦd_{ c㛦We`/8BSZ]k ɵh@ P6oUȭ/>b7NƋB13r3fهl⍫+EyQ#~gnos|vQd@qF@gx5T`ET7Zzv9ϏǢjF&~E}%hx-f3D8OpGf BiHe3́K-yCirKٜϰP'|RGuC]|'M_:lًJvLsYnx_PbsC{]L{UNShmݿ*% yRS%JG (SW."N [-Ɵ"UKKߎi*w-2<c KZӓzv!b;p/ڐ x0AoHO8^.zs/t|d$ <m߃~N MjTxbJA w <ʡ\Flffv2Ge>j j0n .xD޽ 3K[ h4U RkeFnE(pD`s9қz[:>8^72M_>}:;w8ea>9hЇN9d-%Vr=IpٽD=>"`y@9Ud5KD!qpiK x}% @ b4p9YViՙ}iURd}Zb sb,I'UM}A2ÿ&c#8Ɯ)LfZ[ؖu1N\Z3t'60EIBl4Ag?:*4J]zbWޮͰ,yϤ^bZNi(Q;<#AYcMۀ4TQhKMYSô+md%ZXW-~YtjMHzLf%Acd'8"~@K,bv%\S:Oѳ<2,vV~?Koѐ$ GN+b:m}홍HTַAql{-vHtd6rPA[:INnklE]<"Iqʟ? ! sNz,j+kdbTHX*+-L817 ,.Lv/NaһerجXX:|y+Ngʀ@YAtE CJ|y;+rvr@[ $z =/NhKf xR:}qŸM{n <6<=vz ;^rhtss{kX I4'ōyPv9ScO?]bкj~ xe?Ǻ).h]3CL $y" r' cWEY<Ŵ[3[l#^W6F4IaS6{:eh즬^>iDe0yLxBIakmL="'qZ4 4qrJJ1H)W6[ Y=bR 7Vs5`n3e>2l@<4 (/{Xcz)Mb?ON!>=siAju:ujb'@ bs}WJQ8EI n]åW9&r^mKn"I x  חpc#%PnkpjOfX_e y\pA<`j[]rdQh!$kN4  Ůa`:vlLC0JW9!ٰrr2$ k#AZ%tԪ%PmǤ{Մ.y (Y2T.6{7(CJe-oR){jV, LrӐ+kD.&YF`\RaP]WqM'n@]E46r6]eU0n$G;AAH77ASpWc,{qEU#&_h]ɒV>Se3])ț 7xgnZr@RQtXZt̙,Zq|6ZH ,Gk!o'R(Hʢ^y0U7X,2 m35Or }gfVua')F.l;Ж3mE vJY=zuߦlW)r>_NW9 stc 9s+wqiQ=9JBhNuB~3Rڨ@V'O P~uA-jU~ik(6)[@eKvo \VNO_eN-VI򤘴zlN먀NT|؅SMRPGͶ '`#` 5S qYS^`tix$שC E4t >]c$ ' 8#]V2E%~0 "`X~kD5{2(6ZbGJ/'҂ȺxE JTu_*6/YWыye]/RVn]b[rj{>[EWD} OFfF$(2t˶.4a!W{Y)v+u&hɛ Q ύ:tbw@+ƑT{vۏP GIU=&MT B#Ddj. zwE_w&o+3x{V4p1QSGcssK[NΒ ֨ѵbV'[薞.\_v*&qU5'imM1]١E&"ٵgUBۦ9 0PϺ  h8\x{4r׏b%fB~J -6ח eC‰{mfi9YjC8_Vgtu7v2~Dq8kԉc5T03W>TbSջї8&*l0tG-zd%f+22;=4kE:UY~+$'27oC~@Y0> B;CO|((XdϤ3 #'q7+!]P4Ea,Meн MĬz#n~ +VTMcm^.}SQj(Ȇ&k~0ؠH~%M?|}ݭw }u8 ppw}`8~$-],q8ut [G(00J#1+z%dgH!X$ԁaEAv)IhŖ]7pJP,ez $ӀM MB*ouquǎ󈠙VWwMm,oI|'m{wIlcBs[NS1$JCiM`2qm^wn-֬5ep5dƜA",2CJ1U?\G˺1l/+ާw7>?:}j endstream endobj 276 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 278 0 obj << /Length 5184 /Filter /FlateDecode >> stream HWݒ۶~.Ol[;KM6 Jl;}~)Jvvdy[6ګEvמ7&iavPs7;"W|In8oWsEy?`qsШxI̺ oB\˼,^8l-Q]}^RσB'k׏fxmIٚjybwX0MlMvg쒾^lV֢eis*&`M+CsO[z`{@%3SW NyeP=0U[ޟ8o(r5VӅubWlZWkLĶ:9+_i'䩽m 7&=jQ75 km髼0eMt(sO5Nz#8n ,Z/R)$fq9xF.#-cf8|I5BWj aEiT`k;A>At`UR@JiiwP2O<ט2zd\Uk^ 3 dmϔطy)VCKq G(!ٛFl%OTvR^.W tftv+ֲ pg$Mw2r$o:iRvP-g!] :i^^D%imLB5ۃ@3z-R;㼉!8I L8׃Q9");q禳C]$~}yowY3lH!~j% ;wB=w{)4'p uMw$'̚~YEt* ˴儑u}VeB^U^@q Bb zH&s\yA- ;Y7,|Mn캦'W6vlğ3XMYU4[m~zǫjxN셙U_MGq=蒽G/y[<2}#22Ύ 8_|`H5ESu֏jbFC[ £F#Uov;=$?0vArL[}\)PE]HA FVt cs-ȷWRxs:݈c-|&xexY$IL9аQ= 7]/ zؐK*W`j(B&yDcĠdЍE\ߜ{!LaZ~8>ڃɡ_6_>e߮߾ݏO"TF 9_rr-^KY )al໡Ivd*C ,d{y&ZH] uy MҲ1_$:l4盾1,M94JEAtZnjc7Z$}x!Wpi74~Y IR9tˢh lv<wfUȎ9C4Y3=toNJef*XЅhK\釉3hߡ߅E67eKN%]@*:nf́ Pg{%1S˖2ᱝ\ߍ<{3;bab/v=se,*R^xVPh:twSb@C\afQ?=LB~z݊%rU_'Q5D\2frϵ\٩iuXkH,oo_Nmo\xLEBB9ܜ}IX/^o&U3C/AH7Uch;]0DGbA$VG+!EGXj*+eAƭXmxĚ@HT,MY|6%:i vJ8{$±w̷pbؔE+h# TAЎCM)UnU|&T:F=Մ~tVNPp퐈L(;HCWSDOx ,+")XrrU}hʂ@' +br ,0*Q|Ё( (]Rr5ϵ<5'%jȓ ,׏ڔtfT8ЊH 3g='7yB@CF2_V@v'Fc)Iz2٬*un%V#qFp#G3Hx,[yMz c_ *d UȤiX|Op GTo8GرD9YW{[qnBF#k.Z-ZpVc݁;[X2if:XZ"2HlrzEc#5Qw]7ź:(9xܩw$(S?v(5}WMx= -3Ѐ9mDVƎ]?#BwP9%tw6ƃΑᶍ$rtlXq3o$7 ,_ZA OΘ?7>k٧nܷ/ ]bɦP}`}B7vݙb:+frKJ> |  WtSm@~iLwX32GfC0W{gN֮`x%p'˒벥x :UdEG%Y 5^'вDe4edYGȷXI ]s\GkWU$+m7aa}Dʓr|wySrgw`9cxS-r >Eic#`OU,4e<ǟ{XKSF1KΕM_&eysŧߴa2Ӓ{FZ? cZzOw|ťhA<x["f;͞D.N?FV$f] <6Rd_n߶%U&wԏtkP杬Qoehq, JG*@D<bʬ8E.]P ġ!lROG~(XuS=4>AS`լl)}i@ΕAnVԯ2Yo!pCV&,Rl,j!y,E:'c-~IPޏwWW+Кu1U'w }B"e_5 P+b!rມ;P*?%B># +vC|>jYW!ȃ#r+vkAdWg>i#0Ďq/P D}oʪ5xz%qĶ7'8fdh]}HZ.䤀R٩x倷h(O0PjNFotQUtg'Ku(:+8RA*3,߼c]O 3ƣFp(E3XcRbѓ%(Lhs'πT.J6eϟ"Oeqnbo0i6{v`;^r+!\X2'<%g4nEnCQ=( \0KI^1 8T>M&l\͝x@F[MEO"C 3v-Xz>MU,kaWWy3@*k>8eV}n.>iZ1ǵϝ`(j&xYFn :SA;)~$+Awcš}{me]wLc/'FC[gl bOY#EZAԃw8X9?n\&E ;zX_`Ru endstream endobj 279 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 281 0 obj << /Length 4696 /Filter /FlateDecode >> stream HWr<);@aKwY͍+a ɉ O$ Җ-U٢ӷ1j}d~,0eIXEYVUdw?|٦(JpHYӰ, o#յ}%O4{j3k}ޒ<,dqDQbmە} ,/S''.ڄQX0S&U.MJ6~hm%c|ܵHaV7^R+z^~0|W {?0 EiXVy8eu 僾G(7!*20U=\PJq IeJ%mjg%g}riRyŮ0ϋ]'a.m:M pzu܄hYeUxj){; X˸se ٬F+d\3`Xq'lmt8[gEQ0j\)\I㏓lOVz#s{ NkzVo empr,OX c4ejm X?ar- SB4 (Y ZC P>Pm-µXxEhoy/7|6ȁ-mxu?F@KqmymhК AwwpK0MG)17_~'VyR ZhIz4q.1]e-/ȬXDI#3(&Fz94=[t#3zAD=]1وŽGj3u \v:8abV݁0Cr:bfH.O[>0~aݴVY;q0~fWZ; ԉzZ$S~`i 0lX-{Zף- شrSBi3p5q5~=Vxy0&]jrs#{Cjs#:;0]`@'#SnQ4ل7nveyzn팦GʣV{ cժ/i1ƨ,I#jM>O m6jy¡<+&wx #Yr χi=,pgkTy 3I؇ ;Rku>n6/*hPVq?=[cCIl9dN]^'Yy^cYu; (ψL"t \Mp9U=p_h ! ڋHXR+ ?ra:7QL ؝n?\g2 O{FmȻ_R x[;>tS=[Qiz^8! kx874s~$<Z%AxNSP#\8IP6rc<Њ]mw nBӱYĮ%.m%`L#JNUCG]0WYUy=`8Ě- !%u,6=F2 "?r\VqDYoJ[G(10ZpKs!CDӡbF!A!p=9b9avnxJ b\$gZ#v,ӘrYr֢8TI,㊯SI*.ە;"! P;g$(H<^{>q}Lc< 3^/{/{u^VʨE6Im9! `vTeKJ>-fa:,*Ѣ0Eaf^ $UWJ%qW(" wi I =&oxC{S c j(W?D;! my_zQ^X Ɯm (ْw,\5@XXo (} ZiqbhYQtDzރ }RCCąlQ7WD?6@ƺGy>fIm,mh;I4 ꅖ\+H~D6zn[{PRb'sc"0đl$5, SAB )/WtlA]̳><= ucy 3Wk_Vod b?ȌDt*"+XȽfߩ0XY]~W]n)u"36a8=ҕI;F٭\I4V ꝥRfKb/.L9A6VsCk͋v2Zvb_%}=I=Z&{5v㑭`>y,ꋼAA$G~oGwuטZFvrx'Q\Fp.縪%*WtC[2z/m[[4Vv'o >{5ښ ͓"dyg|a>t t2:}M0#xF`n8(" 5ixp^?K!UL9_rErdOw^Š4Af܉6=⵵p0R-)[oeCJs+ZMWP4!- C|غh4si93wp5P% 5}qQ)(/U[( QTxGݝ0n8kTlj~#w44[NӥyS>r? s\֨rEHiQf8^`1_ZSxEǕDӱ`RbӕC~ܨTnO¿`'F EW/Zߠp BT3Ws @ϟu.z_~W* endstream endobj 282 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 284 0 obj << /Length 3356 /Filter /FlateDecode >> stream HWrMN0neF[ZfZa IXbT'{$@I*R/OXor_.4, EgX7W>? ?bk˺Z8~~W>ʶPFTnШN]w5~FY%ρ^1_]Qn'rz~2ċykg Y{"OwY}ˡw;Dd[[kQȣ/~H`?ڢt+k;aͽb!dD]=H&@㗲lb{^9(M[*U.nqzd^D%c˓rM&™Q XN"SOܴtN8d6a! Zm6֪:8w-^EE){iMk="Tv`̠~ Sq̆em8_@Bo :̺WA)(٢GlPvzjJ #-,Hd($fl_?}%^s(#[Ij;ŃMgUC{=V LU{feKEAKrhu̕+ h]i"1hRC @{jo dgg6 唘CAQXTS`~T]Kͼ8̀(_AzJ0BH͗WKDq)LDVcԝ6تV^̢0Jj# gqS м֢j4N&ȂwS 3tzPuA f*"P#ۓ "F6zQ=emV QDJ^8B IDsh㘙 Ɔ@9{@AoTS-'m[3}):$s?xUNQ] #aO䫕kf7Vo7>U'u{d빮 B[5iX,*RW-V@c 5j*u uዒU4ةf& ϡk7 $>%:+.Y;'hb͚*E+v ;; t\qv9AX0a{V͡'{v:T@NlSa·:G&[x?t 4 ]؉9KUhpvTkoYX1̝>Pu\wL=/ L_si-sxɯ r BnIs5 c2{v&㕷s7Q9;olpЅJ$kBXhtk-ؓJ;gI aoBfħ7.h݇Lv`fc0 J Nحiu/Bcž?f-QCWqmHQCߓk%} u햼6¶hH!i9$qj #Q@2_2,Su'ڕ;iG>:~3ʸ;Hʍ%M:өzj@bWG|BVi𺙨!5'q9WDžXi*Y!dV]uqMM2R[U1AX e2F4ow^d"¿K#qnež1Tj 7`CqFAֺ !9w3R5{ʼn5(Cx g%]B\ĨxNV±^l?Bvf)rX@31qJ/ P"gGhؚ{e g.z["nƶ TE5~&;ݨ )*}1n+˷w'*U>t Z\ / YdD2t܉dѮ.|=§ARH5٪ω6ֵ*N%H;ѫ}Zz 4Fq4;W@x6k  ҆"d:?E#hOѰf[mM ܿbƀGWh&qjx9>)u|QQhy8ٗ2(,hv^z閁LZf껑xI4f"w3ݑpA$2\.Z G gB0yJg^fdTX0_em Owҙbu3i +Qp!޾dJ Qst.T2ĚFos&eFyyOe8OyV^P-^u u= uc|ۇCLԮoϋ)Pl?<ʑCHPzR!ձZTG d(vy]A]nϺ{<4Į1? sk _$$ r׾m|;f+m^DAYbK޷nLe1X9;v>-6[OkC!!j~'k$4'X#iң.yRUOTFW/uq)"͔L8Kc@arwUI +]|YЬ9/MӘ3Fipk:~UP04`2U:vtyX#+SKօ@UR B@)nK<ϦRED-6A)1HIDM@4ңUBˈvi-"*#U%m!j a@&YM ]SlEY{4y|I<2&;SP M7;N"sMcy]0^qH(P@F(1˘)%߱j제@&GX>r,ohVplG]]猳,(L(V3 !Jr. 75TtI_X,r WW)"{ endstream endobj 285 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 288 0 obj << /Length 3544 /Filter /FlateDecode >> stream HW˒>J6  $[ڈ +avMADx EgU5H:hHUYY|".W!jIX2 aTݛFjna.2ToPP"Fj_^;6ʵ?Զ`J^JydT|f&Z%|ݚSxjܡ6Q}{7;5fש' >5xȨrt\Ha?y6LAeDEo]өlNiQsC[S(O1u>7lfj= V=n ku 'J`XeQUTF9kԡrRQ4ZPqq5:jtRa۫kup[4r+ JԓO:F,=A-g귙Z"8Jph.]+quhܳFQ:_lN7žQoj>0Q/ڹ'eiZӠt؍9L8Wo E͔Ft=]_}G9NтۣBtjv4tE/@Jd~Ϛƺ;M P{v#AѵQCѤ* gL%Tx_;\jJwTu|nBf~r" tc6̾jm5}t pIKWU,QnjCI hK`"rieA_{d^^?ŸZ]k Nre`rĭ} Lᷞ:yMMعi2-a(vj[vry򉥋!P.)xgyKݗxT{7`f斖a$} '9Q>O<ԫץRS YQTCJ[ӷG-SGt8a=~ Hɤ"ꨥzۚk M*ee'tnj[ Ug)ߛI'Da OBwr/֦u"Yß17ʥǽQ<ײwm=0@$5<ƉTQ,n艦żfAEӸ7 4 ;IiXlDs(3t@kǸ}mgA hJRSOU݋%YX:I6~" 8^܉'][Cfy:3,N?18K\~H$8$bԞc3L̡EMw+wV>hkQ}9m䐐嫷(1* Eӹa,a;c<k-w ɬVM)KMkcA7nAn׭J|'zؘE# /`_5z2EC}~8 hq x^Ziɭ-,$Vtl KF Wc)"{.@gsGk/AMmeB&7PT; rbi7C{8w|u;?r tg]j- foii$xXd -FL15aؓd1,(2*7,[ݒv2 u%5$agr33$T0\2P#gj +̯S7(N`Cᢱ..PC[T"/ >kO2Z!WX^%@z3W\z-@A0CZn*Fˌ|ֈ#ysYux Q l% ?Ɛ˪Jz(kXc,V=3 +]vfΙp Ѣl( %;W/1ǣ(8.|gdH?? ȴYAމ-o] zd&LM+0-MXmIҁ}'I?->{>>cCzt7|7 脊-.  Cr,O(eQ;oM$).E*SNmܱP(aľ0LdrSƫko+s`ʦо>iK]LXҍ Y'&c60ܐ&I9Z )ʍva 7HxV7^;4g mj'^qm7kA9?M6 <tf endstream endobj 289 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 291 0 obj << /Length 3429 /Filter /FlateDecode >> stream HWrCFC/7ds#6aCB#tcƣ?̋CP]]Ǜ_qyS ei(88 燁xy_cys{j+RiQ]'go]?N{J'¬q7E$4O]C{^Tl]_W8qqQ/Tt{ej||/=G4ʪ֢R˺UZV4^zI^P$ O9D(j fkS+Zw[%bzk!Օ'[Qv6t?/4yVb/DU_ɶt7|y[Z5[ti4 :ܙ(㶕yS]qV đ%I(PB͒s."?u-Gi3,xx}7[j1*ت~OnavRxDNKz(ԫgQvMSj) ro10t!>.D߅ɗYD8ѵ #B?~fyTYo^Z[Tz^͏PrO2Ȧً2fyrl"XJy!_9ο1X$<8 [x*c`^B|+J]|1K{I5,Y3_dDŽ5Z־/TjLIkorhd/jbL4VJUWyMEs.[ÈX{<`ܙK#+n@ NԆ@<0bef4\xֺ qWC萡&Yѻ=̶nFsqbPNVo8 ̒EudqoUΔO]qsѹ0r?,#n|I6tCnx#BDӵTA,([I̡ Js\|{ދ#M8TgyG#<0 !㑯B^?HFp߭$ 1B4tNS8, Po ~A [kXf+oq\,ysۻCO@e_|[DnMcUhh[^Ҳ:]lqtk ^֪Z\04يb{M|b-@gV.4 d% \/ \uJG1v Ӷ6jYEV6mfס(HZsxH8VŊ6ޜCZR-e1O@.X -n=̱GcW,gHAN˒6ډ5?~ξ52zlT!oۮa,&zK#εnAh^pV1w5ݜ7,8e>ޡ9lְ3u&| "{]ZP^1Y ' ٢(3Pt1S8l,xB UQ 7M.E<=oG@4=YH0ׅ^Z4*f!ViOW ZH-3kZj$h6PI+v/dAcȧ$5RDkٶ^zڱG*/<Ҹ14kyAkli4*|Bev'J$P1H/ S]u=i|>v.R^&;nQ,<[bJQ/*0,8o(1]Kno\n P];Ƒ0 (2l0wT+`<Нx]qKŠ?{qw8qJ{-J>]-{)ϻQ]u| ww\W_yp yh~bB|/299~דjcVv{ JWMfKHKnTZo4?]qM?By)N"#J O֯2c=2I}dd/7LSEg!U4͇.&5GSj!&'GU=;DxpE(4E헓m,W2lGӎaL֯aTUܑW.GR >fhcI בJ^h؉i ߼> /ExtGState << /GS1 12 0 R >> >> endobj 294 0 obj << /Length 4957 /Filter /FlateDecode >> stream HWے۸< %~ZlY׎RyXC"{W%@ ,\'ή1-00œET=yJWhA7Eԗ4`yk,,LXƶ>$W"uV4õԯ"J6Qϩb& ?n#ffR:"p{r2ҥ/;@/!p_qh̀1Uat+I^ () ˆ6`! 2dP$)Id)x3g%*QG՚ǰ dwog`èI (IUu;dGj1w#' ja<0ՙGtWܴ"}-epQ4`%QA0JLE<3߬(d6/!'BPW :H+IV̐qmZŖbZUmq;a( rLvCY P9`ղ'=9}KR?JVlylZsT>%<7)O㸜ɢHW%eLu 'Ebr/XX\bd⶛ !F+0qiO~Kun'* \9m?C\gAC®hb=tdT1N "GغD>8qhZҸ<ho[Ta3ъre\RZӣ(vi5[lfGy.p mY +*>CnU@1NJ۠ ]UIC{ZXlyʯt ǹes]j ̅-@@< 볧`=/apDVR P,qE1mYnA[ֆD+p5x&YҷVv?(e)\\xCUGI_?Lh]n_ym y쟍WeKBmW^l,΢a,]7s$*k\(?pVQUU^Q|2 >j WNFE 9»}k(l;$oUz/8H2 wL kv^T˴рtWڠ/edv1_&ZVRN*CLeҀYfpS!/MJ]@c U(ݶ$ܷ +!f1'ؗyi-aiV4_?ɦl^0,UwW:palۙ3x˽Zb|.hޤGnoPWяv-W 4[AK5fKQ o3iTtFJqU鲶c2o0 ;,QOl&Ʒ҆.y ~f'as͎w*U&]jA B y<f9+vu]]vAoŸ֏e͏{6E_{\ lF"WqjV> t5<9[2ؼH=[ܽ_O׻ELRitސޒǼ˶ץf3 ,#` *87BQ@wM1K}dk;A 71#tؙtdzKkftVw3 1_ r B' _vKxHlESo(G$5w#jP)(Ju EɃThLq_|Tw7,xg~ q[7U W:O-Y- ^I|_/&c~]hEwQtEҔRMFFБ8Q6`ZS0JыqLHҚ{ [{zbX9E 7I!7䎥e=97ImƺUnr k~dO&=aJu'<뺋|GD$OG Hpn)v+҉b.Y"ioHۙL\׈"-jZ=[ԸkKA8u6 ؠE`'Dg?fkdo gӕ2a+$EeH (ve((6e2Yߘq+(, e%pdďIK{Df/ ӝ,8g`3u8P`s8rLC{҃KY ?&T"IAX|–דٯ7Ҩ]$Sؒ[;2]Idy C.;y|ji  ;t$^dd5XK|;NdV:ldO8~hO9CO4MGlw EBdfl(٤QI#wtrp*rDžOGkoCJXibEg7ҏLoQ8R   8ߔ@nľ^yF|=xQO9S} :;ֶǰGD GI6@2DS9\-M_8GQei#g]\e$ٮ^Wf ̦j"zr3"( JK'o13'GIԌ@8A٦al4 BQ>3sWZbhaIx_/gblǞFPNP].Np센V_mLmlTJ|E9l\ ?.1o!QHT43(_I\a{: '?l24/!%LrѠGm \B|m@}(>ȿ6yBbLGģJɌ?$ߵa \h&G¤XgXV 3:|/Rp5GW[>c<&CRUEDe-)zҔ0t`h-cdOs 0Qi endstream endobj 295 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 297 0 obj << /Length 5454 /Filter /FlateDecode >> stream HWv6Y"Cμَ8[/KI>@$$! /rlh6RnIpn{sd:lEġK"??rd9pKJooǔ+<˱efE+" r-Y<2]2#9OoțWe4(a`~pyVNĢvB? ^ O7^ SW&H mD ï%|[2kҺX +i)2:4R7&&!Zǔm3Q Tb&5_\H(I3[#4 QDab-(权$e5Ke&(`kr\5)h6dɞ9읊 $Q*Of$i[ qsuJza+3YrVY'ѷzqlnAWL,7sB~W5ADQW g2mZn& bbE&"kXBNs-;w!__ݻ ;s 2E]3ܫsq`IJǔ/ZP TI@ P%hlRt5! Rߔ+Yq]zB^.0KԽ֩?4@/jx9WÖ)x%+>#A>GQ`BgT59@SI3aB[!-Rs*J3%f&92ߺ\fu[0N$+ْ"ՀFϥ|VS0 .ΐqMaV1)6PlUl:]lUv$b;Pkrf8z4pc'OIFv8uuEVB&x1$9+ȣ 8fx@9j{: *fkVC,,ttFDC[p ƨV53 {Ix?"E_ܽqG ʦhCBD~ ]Go :j!A./T9bB+@;/V5by˯lRsi)dDt[\Vv&AVE!Y) ď(e=nVlS?:#e]JU1i *VRyK:oT &+UN]F?)ၖSqѻhDwX WMyqDѐ BSZt$w]yHJf>Wb羊$n*Ft9}S4u|q=3erEt}#Եqw -KX4u*Gp >}ħDELɋ{ǟTE{BX#ˁQ|0\M4ӏ1^?CQ. rc1ԿDX:**8H#+c6˥j^q3o\ŜBQf7ȺK` V#cL}{G mҰ _@J'^0&Jb VJ y61^+%޶I)[q(pW_7P/2fbMz{:H^#vP=ʣ;;r];UʑlF8 k"a?õcڸ88;_GDQP~|aC33W^#*j=8 P 4JO7#Pp7kKyj܀џhEd(2SUջv}zd!Vrw,*,¥ҷW0A:^"Aݓ<,7u5Kƻ=8<_ )qxgOר:!vYaX M*`ߧ_AbAAɩUM]j _fk7Le]񊲅ھ~/en *{'%mgcLvڛ`xPʵOw䲪d*t $B+3 %^x@~iC2#N9Ǔidqɴg7kHq0 Py)f8Ci *ݕ%_,jk!YƝԎRH59]ʛJ, 5Ȓ^GscY$rMG|&0(mtѵ踺 x}u[1r)3`q^x̫+ U?cܲaA=0$=4 -]ꍖzQ蝵R/)FJeB+i pץ;wh ¡љĔ.8?\65`ͭK lj~rNt#\59d g=V$j[lvUt#ɶOsAUdؔ rm5a㟆]QH5Sy,mQUzBq&EKVF$٩ MD 1S hmXrw\==t`a{LQN*k.N-׋ yPQo*j1pX\c3;B/xƷu^ It{U0)#^p$GKCh2vVf'3㖀.)A"ϏGLf:UZ`Nrh$^=4 R"kFҺ: eѨqgVY[gC#eC?Oc7/p׍D iV=7e]䣃e7j6!9oZ mh(•nY ^U?j ڷxn\O!B=:w'-\gy x1`da%zqfOes=(> cђO" nЦ|mJ[k_ ٭޹XܸZ3ˎɨ{FVE*"G L]vu`VÚ}MԪP.3f,ټ_1غ^QDGpX}7Xn"=O(I0Mny/$ ';ՕM GwȪ(x9BgGAlO;T `X|m4Le]sήd=%.<I6\&u q9Bh* /&NC3MRv\*[Z̼ cjs][Wm2cx .u;nKԾma@=WTOp$> -m8Aj'354|sWTFD丞-nѪ9;99 8!˺jS`w{+hiC{I t*xPq x"J9=tzE,2u*,-"D*O\M|jlx]9$CI@\uI7q!lO>m4׉}/:f]X=帥uۈ=:gjAVCh |݀)n2Ҙ r)jF^VT-ȗwd4UˊopK%G" p T6⊟_~Ƌ9,Fx~][cw ۯ{+k7JM%$"!%vv9,|˳CV'_t}&_FkZ>HDn={_F93^K=p1)Ao^(-) s"d)GxV6y^0ѡO`8@y ?)0Gvbi$n4QPOyѝ8B-XwYdUU{E9bԺP_ |p@5OV NȒa3Α 3Bq`e_rѪ.c$HӋstJҖR*@rT8&5w١MLGr\ՏJEb\ou ߺ59o7#OwEkqAܧkP|? ωO ہOB]|Mp r+4tCӫbq!Z` PFh 9M&Gt(wkrLJFZq6 uVj W;z7g 4oƮXUUE{&Zȣ$ Œ5auF!ײrX~A-ZItZWš$U(dG0GK'cٯȼft6.Fɉ^b^ |*12$1Uza@Ny3vlǐcJ#bDףd ?.hdZt?-!"BKNh}b`2𣗴2[]UlN>< ݰ?s@.f%DQ?:&fRjw. J1j3yOyrNL{ZU)uF> /ExtGState << /GS1 12 0 R >> >> endobj 300 0 obj << /Length 2004 /Filter /FlateDecode >> stream HW[F]A>|NN<'A2`z>($Vd),R,(ɹU$UT@u=ַۻ{v12槑iBI0bտyW?z\u݄m =߭ƚ8IxkwJO-Oy[pD˾ޱx8u}mN5^`fg=]xg9ae,S'ȲB6 Q|McqvwHg-qQ,Rx>b/m'E&|?7t 7HWۇ/HՋc,Mۊ:đ}3-{_5ے>NND% }-~'_Lvs$1^dC[#`<7~d`bQ ?Cw ه[pp"mo>ߋf;MAlVW8|xL Ú,hYNIy <y( J _B( κ[X+wy)6:T24sDj/l/AKj:.֍/8'V>yk8'*? ٭ϕ@{w"NAgګhKq׊gϬ α 6EQ%*ܳofp=֕%U9(E01ޞD'ۍe5pcmU gN6b;yŚ@]H[$@wx9;vQ!Њ),|$3 Nl΃hsGu)*YeVL_=U\yQԵ970TkZ&לX? P"]͙7(tDSa$U hK Xsʘՙ:Q&6˹%k cIpU u-Q!|z֑oFNyN ED nМs]mdGp|Фt6E M8mckZJ5j{k5sCӫufd]MGu3D'J4]|4(F`dC$U=҅ծ&PvMzrlCf;^TEv^FU򗲳 /F3'439WJ]+ Q*ď:Y[jdt*?,3&I= ,z9MP"A# )K͎*?=bAԣuD!װ=sphYiϹQFֲSc(m<{,s mvT581_XIK l g^&"'@;ϝt5Z#K|dMhh**5%y׈]ra 2^8a4ь^x%Wf)8(F.1l\-1 2 la?3k a1yJt~|;HL-(f""9$øwƽ?`% pY=MDBK'Dk;:Y/WmF'\?,*׵LR%>hֲj9r Ҝ(p9E)3#!?T*7:$:LwI5SZM2@{I#Ҷ|hXu;}OY΋ Z䴒eLF zӦZ0N>A+_n{Obc&%Zh-C8Vb8 $JaKYŦ˨snDXMQa]G/m ͩ/> /ExtGState << /GS1 12 0 R >> >> endobj 303 0 obj << /Length 3997 /Filter /FlateDecode >> stream HWے۸<)ˋxR(vR%x(R #9)PCmjH6Os~Ӈ$ؖ㿍ȒU,R1Ou<_!gx~Oۇ8x%9mo拷-vђ,Zs|^'s~xuеmwTF|VVI("Z.+.8N9}毿4>Y<x}!IMzKJQd\ I9gUtxRnTʔ(d(_i.V}~bl+RSor,ll#Vq%6,񯺖/r&%~;Ft=@fvȔRWQZX(Y7f:]Z|ѷ‘r9N>k5w#>^A?tus` ԩ15k{|' lᝎFS[k&##o0avݴ7i)8˽5Zϲ1HhL`2ą7S,\1FcG{sG\EER3 U\P_](_>6poM4^;W3)Maw+~8Mb/oL_ZHvwyx@aAorm2OJ(tx"|]mtc w=ʑ/9^ė*}hb/߇j[j _GR%i5ff&$PmRa`/DI6ĿCsGZx@FK94pp'o/ӨMͬje{RlGXl8es{VĤ¼/zgn1YOr3I6HBe\ZE { Z(AT mmZ/rLJuFZ։S7I8&v +Vu#[n2Io*JDR\k-q1)H lN8h7PaeΦtr5l z(>)S \e(y"]@m-lnKܿ 9#TUg#Ƙ}37 .Qq@&1JQΪm8 anDcU=:yv{q3SLBHO oo6xސ$N+ 0xpeV=Y\ B\;6qlp 23,c'x=FE_1Z 0ZM;A$!m% %46CD(ݨ?1%il^{G9CO1ů]~WZ_MK6u0ܱ j*_rU5K;@]Іjr+(d 0D|ᡨ`s,C ]VQ^VeN?$V2OvȓbW*č*vN 8B#ƕ+AcHmB>6&u]>2̱t'iD)ea)im g53ƿ.pv7:=ZhwivPpys5cߙߖ0`*vF /e @Mut]äPfǚ£{U) qʝO8e endstream endobj 304 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 306 0 obj << /Length 2446 /Filter /FlateDecode >> stream HWr8}A?-P[#i:2@wpu}ݚ+C&djg6\K{ιדλ &N?D^}⺈ydq3;nsIq8MwM~zGO6yG1]2\Br#`>f"i,}`Y!sЯ DR3t/ʞHMEv=A>C/ Ĝ&ZT}VM0)z"ʦhу(%! C6-obXy=O<||xd!p6q'Stk0yvM*5Om?ERi.z+5E%-#|P׸]NXr=wn^=^z:KD#_g ՇXFEN/?x5oတcO5 Y `wYQ 4 {B^}*2ejɡ>oђETs@_OD~95f*so͛F\ho1/?\^0l͂-r',AnsSuqBb_=c~Чo9Ac-CFf*Byྕ {:/M(𿞥w|#b)Gw ܾǂR|5g nƋ2b9=Qmu6r҆l"9uek<.\%S+!p*5Aؐ wN%ݽآÚw1+C#P}6G]ϩj6"-8@-|1S1]rګ!հ2O,Y}/p*XJT#)Aɢq,a:R*RQAr L<,.v<"[hKL,$StP {߾sZ`/d{a4E,uhhYV2W1[_*do>@(Y-$ɖhcjى!昲^Lb^[Fb*#4RSt=,*tLDHhaM *ٽ 2rf&_encxtSЂwQ)2zYn2pqKiI  /&bA3乊ed ]Up tz#,ϜP3V8;fy.wPGL2Aq/XRُ114?Ocݼ `-/ *Κ7߫V y"J&BkGP} &5:)>JS!F0.Ϡ f^'K =AI#%oQ&V8E_"^-!ψ=J] O_[?rqyФjэ!{iij.\g~f!} VڃLe&J \eYaPodAWzBGѳ4T_ N]G`d-pj]wK^4Р֏c, *u8 #fݱ\%$z:,^v"T ^EXfh>J\J=U-zZ endstream endobj 307 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 309 0 obj << /Length 3697 /Filter /FlateDecode >> stream HW۶}}؝OQl~+m&Jҙ? WVިNߧ ʻ3YD^܏s=x$a *OŲU<6q^.%?OAQ%n{{/)Z%YTyone_ӯGB3ٱ7I#*(*8Nm z{cIxe=7?.۔%Im2eeʨGj#RuGd.;sg>EmDҚ}+;yrCa(ܫԂKa3ߪiɆI& ?(=IQ;Y;m`` ;(z-͕E"JloL^uM/.ۈ}qTiO'ΰ?)~VyT(-βJlc޲Woxfઊdyg/>) py0/jS}xH4jZ 83wLI(jB6bgG#_'+;4"o@HBIPQ^Ix;l TZđ?J҈kwmlMfI#HRs= j #az86rpsf.j[ځF*&I8a5d'NYD=rWm.;آxHKG7y 6u @O.FpqVдi]n'~$8^v/ެބ \Jdk ܽf$wW*4FFB:vľ´ii=hA^#{N[H `&9t.$0,֎5C|#|l <*H3Wn;I?̸͆NuI}^,+Z;4!"%BϢt9cMu5k<(Lڃz+D+J5_|=&_ٻO=OYHT#BMNK^5CݠufA&qR^/g|;F̄%ڍZ3~Sb=f{e1KЖhDi?:"oAZNbE  |@4N*/ uKxeߠWQI.ec8_?Mc\S㍣ݜ`}.綎U4$lZAi?֐0Tyti~Wи䬎Wa%agÜx3W;'`V[ w; 8|F :W 16712 ͬJݣ:)+ޞ1o/JWGBd44)x9nDj h_TJ+|9{A"XvH"䷦6BK޲n80{LxrtSбј /kl$;$fhpϼ`ʄp,>F˽=6O i wԧsn(GirLod+dnEx…Lld5CT{&q]Hs΁Z?5@AU!gϓ̭3m6U=sqEzS W%Bg%$)ם|7d[yrۂo&u@w@{eu^w.|c\ekARxs:SGqZtoy!mv];P'nˏh]Aau9J=.w^Rm9u)K [ngEVPrF>^{N8*,MOx3]oWΨ ]7ĮG;T}ib "!}QeZ;??5 UJ"-1/lN{5Dj8n/7QV!xhg+PO"LϚZ'ܣJV~6^mT ;q@#G)<;2u5Z>FR^˝G{/<'Wp%LI0WM[@n#r'xBl}+GrhWM;R •\f^rg/^_`8)4ˆ؛^u;^Nə|y QTDX?MYde1#e < 6G$N82\9 ӏF0)gF?D9׹HqîUͰiRV[ZjQ"k篒%7:d0~!Yj3aisY-9UlnS䭨 9"o,W=<lEyB䥒bt ߵ"E@f#|j{y5L)xR.lp}(kX1GtaB"82eK ԗ,I3@WAڏJi7=⒲lbraAUEnֲiƴJ J%L+ԘmCjO':?tli?W/VJb (/icِi%nAYt@҄ghUČ"P-eG4>ڔ"uj诉V++K`{_8?Nڄ m_B8_|rc_@c=߄pZk|t·a?XqQNx{lzQ`CCA|DtR7voփ?xgBnk+.;e[WH=ރ@3gW C7bu.(΃e ^ X-n kU8{Wl0傯;^%2 hXZͽoh"&3:Hq6W Ƒ?y{_r}qӨo xkrߓ {kmH#ۊGY:wՅn&iif(&yVnow,I:LDd > /ExtGState << /GS1 12 0 R >> >> endobj 313 0 obj << /Length 5162 /Filter /FlateDecode >> stream HWn@ 44C rV {6> {f69_3)y rnFmSN~3?{櫳1??MSNo\c^cku:&lijT`j%EGN,׊j8EUCL`kB d;Q˭(sfl-0ubsķ?U|㢄̦I4 ^g3/7|j*{##F9nn?߳Wo)vPUFv0ҁ/E#%{+U3[\,7eUT3{nqf'Ĉ ^WowWIxe1# EY$=d;-L_L`XS{Bws #4/yEvc (p?%gfox*(7p_U~|I8LڢQlY`؊#Sꀴy38c{ 1TzC2^zP$rIe5lmz#DϪF!PԏqY|مFĦ!:~ϗ:}8˥)n0 ʓ=/Z!g[Rp p;`b<'A0Ȝ`0QAl iz~ڞ?Z4; hl}]AhkHh$M&~4.n߽@ZjpfuMbFgDUc8'x3?>t=Z/^k(Q sh TI4qSw-h"®-Hm+ G `Q~')#.)ҮIڜ::a^J֞ >!0{.SYd_? 3݅Ny7 _^Mf+EѐSUp06s*y0\yh;l=t3݁0Sp(_NK I*$ֽoj^6,ihբ8cTakŏXYPGtcA2ֶ-r4wiqvu8Դ䒙揃Ne鋽w`{jm _B[\)RtuS?|܇^ǧSd}) &|XW~4ݐ z}1QA!EeS~"Y[ n4S0D W׳M:㻅Ywb\™*x>m %2| -Cm}K.wjgg^Vۅ, kutd[g/2JeGzMD cB>hᐸG'4;=`ǭ%"+d{l>ў͐'exqT*-=eFzRwuFRKwFU1F46xPԄ2uyI=ի#0 L.]'F{š0;% UYrEU󦪏^)CNj_RKL4?b\ I)3./  OƓYw7 fѻjw4v n8;FOW%OtnwM:0ǭ~q.~wF{7CfH‰ORWEw_kIAWMRK\C~#>$;֙d8&>*;17-^葻 s= /%?\PHZ%rV*`EFddf'C+|/c>\fH ~+AؚIBd 8\rH'g^nv+.P..6C4 m}UGX 9ƃk]G6b^$^aݩܐ]ixYv+L-ԩ.5@djRt}\m[i' ܍@0 M+VV aE;:bt˪r)FGy}KÂb(ih^jG}&3z&(h^gy6ftmKIvh68qݤ 0hq' i,*[)Fn82<62~+%>@%7L}[?+̞E H5PsC鮟Lw?44VZ|M!ո&kY1;VoMo(ҕŰ:-  k @ܬedO_e4lp0_ Ra/ᬝKvF[OWB$"XGfYpVcѱ^u;RX |j3+ ً3锫*JjJ7+v_hcT50>s[7ys?5:?= {u +:(ݟn]k~[ ylp;{AMh0v/576d &LפA'ȋ I붇0v5e:?Sj q:FuU=$=.4 fhX0ZQOQcU/pAQ=NyV:6C,#)LS\2Md|D"le}ԓ/nJda 7K.ڀ[&?ح}^֓@06;tZ, 3/iZ[0<}-*G?P{4ē3IS(|a[I"/N%O/L^LJs`|?4 * 1িcL0ԝlkD};p=!lyD'#B,j# _G6JkzVd~rDGgdW!4C!amTmO9Ƨ戋B4국];=: :PQ(ǭŜ.p8]^D=dkIWwӜȴ`ۉP˜_ȖcFz,M`S3|䑵Aʭm^X|-OcI+(8I R9T%O}q$*=At΁"!pKApIq2/)DYVjh4|5яLq7SpF%]*+Q`xW1-2ݙB`/μ.j/$@Goz11;9TNʌs@'=̫x!UIX(" V37r)*u:AI >LH/ڍiTD5T,KNdf/a$E%b .[Xv^ooJ$Q`e)^珊Llaswu^0"3iZoR)4zAr5\ ?Cc8Av1rU+>9%T}v84ŞEeu{?a2q+Yr__WD!NJyz jhJiE\pޙٟpo0["O?h]揬;eYo!([2J5fR90;D.S| y+`q(٢VSRa58d 8(1sDں"<4p j!!f3ȲEddB#fhؾ;`X$}?֍4)j+&3ƋI⡋„fG:y& JT:il6_'5F endstream endobj 314 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 316 0 obj << /Length 4658 /Filter /FlateDecode >> stream HWَzT  C,I5T-+_Pέ*nV:C[ys=Ow> .g>,Jϒqq7?_v汸x|zW>ɆoB -*iW,9 <wنd[ <_wo:%w}'XgQj˾D-IdӑO| $6.^`,&S'#5I()>;˪b;Y Khs1|k^НjP j~*'rcͤ'PV h+E3zNyP%&;vndG,h&d, :g۾cC5W]6'l5G6Q, A{WUzǔ( Fүڑh 0oJYqUOwf `̡LJu'ϓǶj|4g#K=4=EA-ݡkv>ʂ}iWm ۻB$+AuFG(b`v)(^O(VZOQE?N Q:š-8ڷX_JPRՆ CEQYQ?z %v=ÙMy!4[ wUxRV#!;4VJFi{K1Bg< }c{BZcc d2]oān-2,&cB˒u xûV]` Ejݖ?58(!+W 0 |_ISiyu!-#uO XfGG[1!|/Bےp;0:`4?f.`63ϛ#k/JCAb'n b3E,lő"hs}ldQ.TXϭմmiՂ0 T_gmz#E% IgwTȜvI12_v4f)UWY60n^iB_HpjI<JM)p ȋ^8W2NMI3Q`QexcgXyjK4AC֢]]nicps2*aA9 6X<`^t=93xs5% f!D< hk Bj(R1vjoz%#q*am8Z^th>` P,̡v \tA%+zݵt`#"L/or4QU6Ƞbo4x3eo1_ 6G 3nn^/=Ylx>(Yfel˷Qd)3HR<%!3܄xnܞBvkl2/I\c{F[:z~ Nj8GH7rSb<߼lapߐ^Z9JlOG"=ψ^*h0TpKd!jۯfff]T*j3=Zd%*;:wgbjX%͉zq,!e$qS]м>\i%=䫫! qW.x9]C'Q *قO%>ښaAq r{KgYY vt#*`4d #_W1S 5]k,QBUh &tOvzQ\_q|h捆"/WR5 M]ilS̚_TM3'/u++\/4H{%P1%j-ǵ^h4~p,2Q:ULԨ6m;3=k$ >̒#^ +\~?~sHcA9 g/O TFe&-qi[j̈́ Z ^ȥU[iiy."wu@!^l-3 F$2S]wniwaґ}q_X:7i4Jj扝19?RvidwgY\DgYċI3֒,2f1U/1lj+[L-)D37K x jO̯23UIMfq8RvsAD"XS׃h ߮ZD٤Τh WU{߱0^Pn }c0 l;:9<Gk7 _X\xm_lo6ȡA 4-61D,$Eݙ7。oŒ#fO޴|.c[@iR Rȫ$zBoPD ֬UjtȹYTO,G)`)"^]G e1j[uYttdŸrgl2Qc~='b-0\7,p3HS7>-=vHVf餛 w}; <@ѤЉڮk0,b<A6*5 CWӮQ{vYJWo.T35A o5/898}5* ̀.i8N!淺E(t%zwXYf }5  d¨dRv]leE4-܋0JJQeZ`>T:,&a4}ű FӅIn vLR]0EG4Ss[ 0Kjp}~s?#KQg)^uy^k|u%=1i, nFypOhZr03v#K0hcӝJ.I(UEN AǞ0%-TD8=vkLqo@FM%.#[CEׂE* t躇H;tQF/ X?3=K =#ƾ]qSCy(3={8' W&4/d8WCϫbL,Kecoj rw꠼,.\ŕj|66X kbd3@ Ld6KfedyV ˀhl腊>L7hwhNnNVX(ͲK5=n׍~zg;iRl"i䅗$1B @3 E8beRLagގP *rB(?~~yz›k:~X(GLXH#/'N`ih;זP,bZG̵vBeP0MkBm0sכS_nD̓薐QnHRwk"465Q"p 9C:`K۞;_#.j[y`"[G Իzh65[LGp*zyER~fH$M.|KUI `ڡ ꫴOg\%9/`@|v7*@T x% Y']®>mXpFVrDzLN?x= ^}̄zjN+΄+ ;;[_\k틫n֚TL%ӹZ)C'kOG ye=͛5չ5?T3D\ѧ>eMUSy{6i$ *Hq<7W.qsT)b'ᙴ>9c^s(-goa\vM"0[eY^NTѾԩMV6<4?ro+>}UTOJwϿhը \ ՉDxJxKk|/VSp( ABx` ^>֚S3SN~<m|׭ae[Bƺ9Θ*ȩBkY$X~ga -_`8rSʎ|*3j*G64 QKrPW53%?͒w/rC>Ai/ɹTc:b-d>n["ejν?t4mˁn< rDcP/9ކVѻFP?z2~%G*]"/-8"43ʣi"]hG - OPEn7! аi(=ճЁp  endstream endobj 317 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 320 0 obj << /Length 4879 /Filter /FlateDecode >> stream HWnC,@h>ZNlâ,<4gd[i\H7#Qr0DrtuթS^..n^{b}2RNK¹~ W汇?{lSEF/fn3as$NӖ7͚ZvVJւ>T짶nNT}=oǎ}_gkI[lʼnNUFk)?ײeٺR;{Y>E%wl fl Ϯ=' 9_FD q%NjV 9d (lS;ٖ~\]'xn^7mx5FUÏg^#q[ \oPW'Y1Q"d͖3l:Ggϋ,{a0FNX6Rڶ5uLaO&.$\*:ۊ`۬Ef=Ɔܿ&V\Gl^ó+բʃ*:Mwbk7b)[ȲxDs5C*kxFG֕@eFnAv5nU=ōA'VGlKH;!Oՙ`q+^#'" ­)*NqoprI'r;6\  !8L@"߷oX>0 ,Z\:4#^[b)y%B;,b{5$|e-u4?GQ7y^hqln VK3OfNl0tL_ b/JʼnAm%0z|C ȓAK:;ꕉ2(}@_#(M"TnaH*N~b.O!ۿn ϷtN9zO>'~l#bhO r^ҵT];dVxDSKwJ&ԅcPԠ>0_D$0o>$(p~?2}{^n](9~cm\ƞOw&/ ;_!tM O-}ִEx1w|◉5KE< <a8L}߸ws@^# lV۳hJ2酖]=*?t,W_0OveevY M I y+!lV)k/* gȶ̌)!>oG uz;L:HcAU;Sw6=30sW= (v><>v LM= @ ќpZ`^Hdhg܋[VceF--˺R;cj&֖wpy8Y!&xɺa4y ܕ4ST#S nHd W#βk7{2g.^0Nœv&G`=JPycŷW06>,F; [mhD T7 ?&0-ztnBu |ٓ-Tc m F>3=ⰿR4L ssWf4\ѭDs7MM3vShlL,gM,4zW*@j+?GU=|c9sȑ/|cW)*k mzlY>%蔄I<&3b~;'ֵ$<aL)[\G}Nk'c~m'~[hkk'cE:w[V68qݗ;H@ɵ3:c3>g?PV{0m7CQMÂCz%hpjEj<ߕ΁3Dq/U6r07|!qI(dfn7 @ Z[LH!پOsfJrֽ3dp,>Qb?uAA>ۧ' oL@ܟSQIK#J2ňNgA4 Edq*ifCO"7f 4 RkoZn鐴 1hj"cN<֮cDT3ߡAWp_x/2BǎTӪDz8,%ը,"Kkz~̵*hxD.ʆT{zM6{pr~)GEk:UtLFMJuRZr#MW[պN: ^sXꛇ2YFRTΝf/D9Ni[6yM;洣ԆufP.m8"߱&pI@iәSa, ΢0Ύ;!GhAܑ;ei? ĿJ *R3P EXoB-%^Q>ԈcJMrn!accAC,-~W52C|BB <_ވ,(,?]F?'oQH~E-3$g$Yhcry !b2}O M@M4["7t}gױYѥqm|Ge'pҙ|^|N^#%ߗQOmNwæ į[{Ch4y~oAPPb`L#mc$ ~ZR I(G4 VR.2Cя)w2N-Īq I VvjKJ9flS~>)zI21X_n?^ёw.C7h=)Ban#6S0s Q-[,%ݥTJx78NzxQ 96(14t0 #fȠ^?إќt>Ϙ-iS*&}K5 ߫O)<@Ԧ>ADvCnFpY:r)nh^i]Qi,gy/( `|C71s"B)SQxKUgA|G;I:(G\ЗK(sۋi_ןWAW+ijBb{J\t6ǢHϦ/Q x#Lgb$_2`y#ɇ_?m>Yb#Uy 4sBC./(,'':{)=QcpDj:UF@|Z?W_Q2tN݀V endstream endobj 321 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F9 54 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 323 0 obj << /Length 4684 /Filter /FlateDecode >> stream HWn8΢[uk "d'E{y%$6D~Ҟ"[w;-Qź:ulLI#N- #%(u4MljJSU ?fuV|F ]PC ڸvIbzy!Ϣ .db9nvsgYȋNJg)EOJq;v.Z?š~e KqOƱ{;[H͊dD{e>o.&W5;u?P6v- vFь#ۈF1N3+J1Rm?-֗i5*BXt35':?6.NX3~.}s7{}?)03$3!@{^ٱ5f sĞPk[T_Z4x/A891&EM?Tq} ke mAxyAOsހaT!T~^2ԱX4_rچΪꍬ^y4?4D-1)x@(f8j{oZc̢MG bb>咒ҫoC@=/ЁF[mNiq~cw~ԯS{5D,.FxsMYH('e|#4/zqr.WƉk MyG`Huªvif5K}oderRw5k?Jya>Xy[W )MV㜉gݰp0:0qdjRU4D>vLyfM oA[18m=pӋie/ymdW(a}aN<  %Jp)?i$VjTsPGd|<>ARFFKWݫEgR@rɳr 6#'ޥ~-Lꨲ>Ed#,<haʃk )["^jT:6IvD-P<.&kyM3؅éJ9}vu}8L&M6FI852%Ua*ذ!Y6,T~}~{R-LkeY>} @PdQ U"YDb0۵G;&==lͯoܼ{ⴀ43bzٯ*o6gyԚC.ۤy=8puhXbȎ"[&`CX{!nnG~cI!W=4WƘ-B(妩Ž~{A;::['q 8xʺ,ٱ7g5i]U[9ʾk`aΣ'[""?/H"-`T`H%%!Nh?Q r(b\B_QN,.Rh"4RˋPH68M`gLZ  -$DZR!)dz"×}vi*A6_ؖ ! ۊ9ڳf# WSB[ lo僽S|TW9)uҩAc2:G0Zŵ,V D^=6exj4d,TqU#{H׍C[kc ɽ鳮=jA6;n7 n4+ V5aЎ, [̷tTgT!J`@R#IgG|tOJD}#wˆL0..3]׳wx^m~u^Wx?  yqgM57{\xƑQޞOΨ%( |y"""1WըĘ'DkJ8ɇj84 )>]LГL3ۛn~$.`ǜ1W3w̉}1s1E>. *ŒJ|B(v&GO$m4 삲“d-sGkx=U:5t@ubrwnpmQ9i8'fY hg F X H1k8IPa4WqBx$A * %t=(^S 4 R4SqBLU D/T*NTL˨ "VpT %\F endstream endobj 324 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 326 0 obj << /Length 365 /Filter /FlateDecode >> stream H\j0@p.Ӌ(mhڤVh0荖ȍZJ%yqoUvauoUņspT5Q`i EsŒ,+P}8^fRD.!Y,&IGlkt=v?{̰x\!0䖔 OEO2iP n7hCm6;)Ɲm\lmMuE^S)KJQ"+h,DZ!{t| I/ӡ%mp}տ\!JP2.F1P;MJ#Dbu'( xFTWcgɅNjȇ\ endstream endobj 327 0 obj << /ProcSet [/PDF /Text /ImageB ] /Font << /F6 36 0 R /F9 54 0 R /F10 72 0 R /F11 79 0 R >> /XObject << /Im9 328 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 330 0 obj << /Length 5596 /Filter /FlateDecode >> stream HW[r]Пtl%Y=V$Rq>Z`Kl Dsd-b3TӍ %OYUH>=ܣ'#\dÿIL4I \<%#w]2r[ᓫ`Qpq\TD*f%4:_/ϪG$"Ϭ2'YW$ Y/qDff,Cu{赖,oITWPRF A UUWƯ՚!B,HkܞdUՅ~kee> ,{It"ʆy"ޭDh&Ƌ¹5xxI:s^ؐPmۍ?YyAfM^7ET}-EETi޸4H~^͝MʗUDwW:EW/u5LZbV~- nJ]-&ioٻQ, ]u ָ+C!vxGC68I/x ,r<@.و@u\ )("RBW[6Q6 P%YGKb~2|;u, 1![R)\O.EQL[ JfY~y5%cQkQM0ܒE]ܙjQd_ h] UMSS%As9L.uQr7ߊu l)mkJ+m-e~~^L_]4KE9Zi;D3j4heo1Ea0WpTt>|d0)jhF Ny@߁^è.X`0Am.}2لrL1J2o1x aӝ*OJ&I4Dr`{cv5;a< S/LJwX8%l:xGi.z =§䨅o0 ;i-Rr^|{C~:OIf 3w.ߪݞ#j/̱ݙ3\ t?l܀Ni4tGW*=qܡ_;}d}{'̵Rwv꿶jCqk[UBv]:[?C鯒B<(bPt#m7 pQ'Y,Mg~}n-.De+kvF%= +|.;gRX Ʈx^jB~C"M e,d{]\k93Khl-U ݎtO.sXAnܢb^ANɱS5da=mܽ'n~ fW%44yGam(ߩFB f? ܜ1*r"5X@J 2ˑ>Ɩ4;o;}]P7me;Z,lx.Rxslф daJflyYVrSqp5?g047no&ݼ!D̑_BK3p#ՠqf~}j~Vylw4ƴZm?y/Un?VSx.0 N ]}1$~G2,}իkUK0Onw>Mc/{^mkcޡ xnJtî> vBpw1Bwj^a *vi{K>snf1ݍK>5iGy"़Lk$Eis欵 K儛HgCj&^J8{шLֆshQd.i'qGgUY긹V22SGhYz^fg<K=˯wUH~vLޓnn?Zݍde%q$}39S as!n&U][z۱orլдFE)cnL!*-oIJ{cs]KG`8N@o עt yzYY6zPË4`mEoֲIө!kR NcZ[Q@Eu+Z8j*CԹ,CrC6fi Ѭ_2L8j$--mVcRBa 胑;!M ɨќ:jr2 l, 1D$;o q~2ǹӟr\~mh/ 2Wwݢc}<9{Q;{ì+uSVhGNoKWə~}{V']*m٢¥ ΃vvsbp`J%𛘑rF n 3:o /D`7C[/ރIF^G7WdԸr785oP%hɿdyRLԡ5IQu`[P`N5L=VWi18w`,1#;?8ƇCp }c̯XJF4儏A׫<"~r{umzH7O/Gofktdis#g~@vDڷ\|6& r]5}TU{&΁9Cs rzC˱#?ڍw# J8IuTC gzV glj{JhUl7ɑ: qMrCTxD;.ceDˬ T 6x-3AOZi/b[sHURo8[D/"F+D_$cdLCh0aozNEc8iǕQx7KɰסZ\ S|恟xcT ?anJx̋DƔ<|D"+½*R8V4Tn|r9ză]$\=჻[s+΅}䉎I{`ӕw8 et2Gt+.i >Ʈ~ I ʍFSyQ|kU~#j{XwF1Epbl96jܷu[n`[6638-VG5bFKH x@ةyA^ N(,G߼w3e%py4ME 'vtN'p|kQ}rOA |{!#xd P̰pCK0~nՋ~]sZ&>Z']`<9^s^=-)><OX̰UL#1a?MBi \s (]kFjt=Ȕ{hkij|X㆖8{mKm'nl;&h;16%,wzAk! ?`i{A_[\<8n$\VڿTs΋8ˋL wzhi}%|=/a􍂨 br0޷ A-$4YV c44L") !qx&;uvb ҭ>d3@gǍCN>NL >aAMQњ:Yҿ}/asQ?)>8N}3L:d˰tMzKɸ-؆,_;T+5^=mNq| Chp`R~d}>Є8adbjb+eTNDᜥ\P4VMQ,q̳|:Ӳ$3fx⧁l#HUH~ j%k mYHsne3įڷ_cQ)bƃ~]\yjp6(;|MU3ݦu\3inT&Da -_2 |DpkHl6D=w"?L_51y2³M0 lFYnٽK,=7XR"kaS?*|Ɉ6<;m?y :l̰& X uGm:__c$־H3G,g{Eqkzzy1v{({o~U fbo O|Nw=D9cQMLUKYUnc1< +VF5LtA~Fj/3>FY,(@XR*GSi!N~0"OLn& z_zw1N:do$8+_+P ./gb~ H̓p&s>ƺV@LV10oaWu czmwCqGvܟ^fZI;~_x}u ~G[5)qb*c$r nHEvF3Ti5}^ӂQzuEAoPL'nrρδď %UhXXUa5Si(4 s!nK:uOKrȅEi>z$Ĭl3@*'tkX_UިˊRi-g`cp~?G9;x\2RiEY!Zfn:dwS<C .fj) {d&˳bT#M@RČ%Dք5,,4GBĢP5bpˁ ԤR` R K=S 9Zz}p9) )L(7al`h0Eҗ tb>G+( LȎSRs)DT'lh= t6%zm$YZBb5 6Kq endstream endobj 331 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 333 0 obj << /Length 2443 /Filter /FlateDecode >> stream HWrܸC?S$M eK%k-ɫLVy8 ŴڏH>!5O9mm% >O>]?'bpO AP]/U~<$7D|wT,"Nx? ,i%ԃMUUzܾ:.B4`/p*ດNTXŦY&~ 梨MЄ sbz`'Bbn:r,#ߖ2}āb "--- \9uA8joLtweqRȧ4e"Q\ӟ\>["`&븮txRJK|(,-*G@(UxSӯ.yBZ10 ֝VNLpP"u UJ<&_पDUMX;.y} 0cbw\QƦ,έr˱F?H[_x`9o6LT= B)+9q$v+ $2 n'KlzVoi18ԣ=Du =*:Bs-C\Mp4NJuHg9/,A@<|| WYw7C\/ ž퓨OYԇt_mT?:^sʹL/kE!vP@^SwzzXtY^eUh\c8/bW\ЫlS"yG7^7-sn6 ,8SƴzFlQ6ұM!k(^dӐ^'(*j|8xt=o,q/yZv"GqHCuLh?IF\ԢvCppʫ4iRrdJ2Q>)қ1 !~֐E]s#ʙFvX01A;ujtc%-:7Gtu-sWbew=x&Q^,˄T\%sO5 *^(k/U=X oh1뀠.6X LsqDfm(И(UVX oZpCOIТ0Z]& b3 .~ά2~p6 {  $t^ i'<`*-qKtcÏW<1 x,̭$[@,.gQg $$n3I1^ܡ(Kt/DQor'pu/ 2mjNע5KO)vҠ#Ô4?Ci&…l? l w|=`AAͽ}+~U UŹEk˪5PzNDnsGќб P1 (;/r-ڀ2ۋ\JExXFaMڐ)~q7BuEyWh{qY^o8DYT`_kQoanG1h&ֻSMe?*7ܕ9R^kgUpb;P~41A](3i4J&BmB'? t@BxV7O/BG te.j(A>W5n:+~T3-+O z4i(M Ny˜3#VG`B? endstream endobj 334 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F9 54 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 336 0 obj << /Length 2083 /Filter /FlateDecode >> stream HWn~\Ң̙3{SqiFh[YIT}~ 9$m/ 4,Y &n_`p\xXa<Pls\Ro$} d]BeKyV-۟ԞUYUlfV$Y&2pU ^`*( i!OZCE&?0w-WY\ 툽>ݾ+ݾ>v[v{Pcթ]SC]Sչ>ܬ6 o$sY^F瑓L|InW]qe`k0 G{Oo ˫갿V1!,?'+Cv'<·<,?Ɨ\嗦:=ljZ~!BEHe=in7>w DnߎDst1emRdӲ\aF)ɍ1+O;w!GIΖ*%bRZqIõ(jn AR}5|Q@yqv'g59Kyc57 #Gh/(>xY$Ce(䊸Y~ioS*̴ʡczwvL}SX6HiTߟg|ر ^gj Hksʊg呍컇QV=Dx~V}xzeNUblYLKٲS1~߃Q4;v!z.!f#v,)\+I2ܔ|5譮9C~J*>~+UBϽ+ {)]$,IC*TzI/x ,$rGZ٢t>B۪:\cͽDշ) ;ѿZ+R7V!$'KWiV=Ia "]DguS5z?a 7ۗeD0tg")'v&㜌 /J_ꦍEf"jtS FahF" ڬȐK61_ìrcB]Fkb1 E(ˣ}`SB@2fj] !0vp AX + 5nBX-K8zSpChJQvX֕[kɏ4KA!Ø#n!U&Fcʾ:!JGO#{G]|׾ ^__ P wӾ0m @vfXK0>,#QlX7)'?BgM;~N[MڐX bWG,0}ogwcλKQu:u5L^|Ԗ'?A:FLM@+Na }@}`? [@"[ύqU&] ~/?NǶd@h QD $oǥ;L:"ZdYDYPs6"Aj*uF59$}vpŌun&pڠΦ'# w33 \a9U]r3#umQ=cU&sXm 1=&bX벝9'qJNɣw^O")z[)#g?NfR2ə CvI9bH_܃ɧCnB!-+&z Z%NL-"w Ḙ5(<>pbDh/ZuL#vT_8,Pp;tH?@dF8" I(̑&#`&44 &#,; $&qR2T>0t qD@@(4 HrBLe!#MF2g2iHC0dd"p)bZ裐Bv}H'hVP,#I2I"$$PN$$ s| endstream endobj 337 0 obj << /ProcSet [/PDF /Text ] /Font << /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 339 0 obj << /Length 4862 /Filter /FlateDecode >> stream HWvC?J9$}r$,{/ǤQZ`1iwOnucOY"Un[Y_xycE\1??MSN[y汯/W5n9Q|68I8_,͑|zsU.&+v+fD#(r8Js|M :ӿX.?갿ٷ̋\'%~YR(Ŀl]';Ymdc^w(΂'Nz/O}(#j-}XgC̉3zehٽVEK!d`wV\ɃЍlO7ZV87N"3#ۂlZB(yMe.4Gd߉,ȶ5ft}>+rV;7r4~XndYbZa5Q0񝗲T5my*/.VqV?pB/G ǖ;IxN;,N,OSB k2dinڲfHT@PEnYz^tT˂5jc(>U[X% -xb(3]l vGcS5؟j Y4-I[ ʠ(keΑLmxl =76R79pZPdu@xе@"f40 .n&VU Iݜ*ѩ\wCTUzj"0CrQ,+ۡ.0JVy 1TM-QfV7 eVю{kI"RqP_ ɒ,ecx@vmgٞ#gZuObdd^t9#iAml8q^ne5}v+s.M6x4SC7P 4de{Hڈ\nʾmrϣ[ pC v2g@PzF"-{`?evsVڪn?ӷa?Bj>:c3N& ,GFp@{'[S]sJ(@vHaRD&*N{Jt VE</d (C-Srh)g9>cbAF O6!P˱^ULE"`AJNZ<3b YI.ElE!Hq? @cG#Bl2&n!汅ِkyk1ib7ZU#l`۶rl6OCP߄ d7H;l5V4V׈zf&p]+c%L< mtHtFXY }[%G%#}gƙ]~g+ͨ2(-$gCZ\FK(+!-5Vܐߏ0EltNc)Zj0 Q(7TXBCSu{ByBGou^|V}7*ZIk0M^7kgX18^P*4z4.8ۚ zmI}?<Q0٨OC|6 ǡ1󓭡GT%SG#<0G̤!"d2I_u a#.y/_WwxkoXS)!(`fSDN!ز/ "KJ 0%6_-Lױ')rrd |]\_@n/>9un:7W.ݯ Ka[.|8 l5;0_R||l- ,^vKKQ nT([!P5ȴ>irLsC y]EQ?@Ba{53rϷ+u$6ӉOjG`v c'T!쵐6eT|:@B=:hzy{T;Ag3 i` _TS a=6Z+čV5^s׷vǴ`/mYI`0xEOgE +?,י RE{:9@0z|ү^2RsYzJce$: ⿌WnH>:M(;k;&cL/ؖ&^hs?hOUuM H".inݱ.u׊jTq״e;0zzeZݾƾu j,-0#>}VcjO!nZ^7].c7LRU'b]WP (H6;qz]rk`CpEF'"t€0oq'¤l1()aoL$sxr%~&cadSMPa-$]OXКIiOk~n$ M7.(0na#?Il cTwJ V@?ͣy @ G=1)|D<:,J; ^nH"t}gCyT6Ռ)jQA?;^;47ˀ9pӋ45Xs= 1`:,FoUj~w=;q8Vʌ"Đxel?Z3|o|XV{2OU (z Dšia~RڟyDԏtEq Iߊߞ^psw]o׿]y_.ۋ_/n~?J#>1v~u\z_nno)·_'2#|R/"0E/$(XeofHP6<Ձ $i !oh;7Z`h.z/E@Ns5HrO4-hr(ߊ mVzfX<0!_̗&&Mb.FsDh܃yD8PNhrG 70.?޽ڪ6s<QUS"8 C& St ΋։ΥzD`˪Jo2J< >{]o#ɰBRGLpx("mJ'P$2zIJ`GcnR띴ϖzeF+SX Х W7ST4Bת5 H . -t=g MujEHЯvV&Ge.Ҋui:;CPrSF쭵azXڬi w7u_,;v^λcH_ai-jӴc1G{+JM+a>\> /ExtGState << /GS1 12 0 R >> >> endobj 342 0 obj << /Length 4933 /Filter /FlateDecode >> stream HWے۸<)M"dgֻVR*y"! `R3sHx=rҧq{Sೀmw'cQt$N=?NB|0`Owo|Ň\&k{U}Fp/įX?c_d^d1>-޳uo:Mf|{d!+Q>`>(N>f|/"rd $0[", 3?ss`97 ya}y+OPUx:Mڃ(tm^.m)0*UiU){R+T{C|dgf6|EJ$ju{ y?Wj2Uw>P Bd*-̒5\2JmsTMCYW,G1{?Z߆D cH-s+$cV'j>J-Yl_F #WY|>2B 6Z߳M#J1\Qh~ZK)P)^Kw?{ԡtzQNvhAmatW~qQ0Q)G~J㿕*ڏʼnÀORBc.QpA7GwS)S ^VcZ`Rn%A~IE!-`-6ʡZV o`4 2Lw!]3d;!!]26XRec[D,Ibs~_ DR#Z<7H]K0n4tɺz++׶Sa|; _5x6zU;`RЋX4'1mN~h.!0ɑܐj9I?0ʓײr۞v9YzMz=-6Um MiaE.XתTNf1tͿkROlR /I;[qI/uVK#i2ؤy46p-UG^`~WRql[^oeQyg iE괅 QOK8pHڡv&׼n[# УNX4dX&UAP?]@l2gԑ 5 W)ӀU3%[=B:$*jtB:)]-"Ǡxv; bԈN5W.(Ӓ+ 2=I!׎N᯲,#%k@1SeK[0u+gYlꁟzDP,44qA=yG Ias&] A]َb?B(qqڟa Ai&eGf9s t~>;MX۟o#)8f8gxBxV.=b!8z;w^n,[{aEnzIFS@Γ_{`5kט}-IL+1Pux)Fvؑ y+J kŹ0 EMgɩJ֌kߤuѬ .ا/n`6a6^bG 4{UD~$^ɜ;nL kIdQic=rH4vh2 Y,MږD* h@sègpK}$=?2F׭ĭR@Bs~(ӢU܅ x-=:# g;6;$1n=ZBpա -J)]\KOԬޓl!U*%'CwrvFj*K&3j}/HH _a0ڌ9IIvSshhv gw(K?DeҪ3ׅoArgzܘK~T:XiŚ /;= g,wDmY&|i!H8ua݌%e v:Ψޤ8\:O#]P'8 R;Olp=0*hcp$WY"]aaP csmo9'룸=OQ:7kȦg/n/aKֹFpṪ`1(]ɓn/k[|?ˮm[ ÿ>3"iک{AS"URϻB);՝-A~O_n7]zG.~ח_n {y`JR6U|uAL\n\(NSBB>TxRmw R)1#დM돛c'R{+J٠`y-?`~j6kNf5&IPh,ZMU /{O"UustJw sSDP_05|-\h`a󭤡蒦.0Lb=sGCE 8f02ԷonOmDggͶ*[w=ȡ{S߄ʕpmyy#(tBմt!j?M*M "Ɛwk_:T6ͅЅ$>}u9_V {=3ΙÞtԢm*iz 7WSN;-""?"zÖ́*Z +lv->o&ճo~ XA2|<fK1 rxEU]7Fddrp&N.gh*[}p(]zcY]g1`IdStaL9Q \qI iBjh$Dc64tّz=zA`UNn!4z)SpHV+/* yiO,) x-k/5pQaq$\7] :ܗBᯪnʾSH؝*YG酸#k\]YySW-44\A UEȢ=~wͭEH'^!¥t }x!nn$Ղ^xz"HENSetH; bzdAB7Hkwû-޴V=0/Pw5 %?D QVK$d3ss}mT!W>-qUf/$>8ͽ ~Gy"nRE,NjPA3 d&v^+י*čEmI zGkה\{C tYf^{aG#DNs!I9c gi嚒FJS9W=^Qf1 SImu ס)(zL]tPJ}Pu*24& Գ㸎R43?;FyB֧C-9L#)*+O`)꿗Y~YߥjN a )al-EqעװNGHeL&4& =tċ1؛mkԚ6' mT lL_G\;YPo 0M\C. Om0@=[f€~8혵}SKMp/P8K7Ŀvh~D}0]CjReMrM{ѹ.(r< g~_mx/şby%΢0P5yL.gIb~Rݝ?'DK9P_6@(L(HP dAp"/ErNFcn%QʳEb[[Ǫy,hh2פtHd'fq\*%WCJleRrWy[`n7Zry 4dUbLԏv(&!E @KX1ODg:q #') , E&)e>n5Z֨Eh Nu|sZ&;.NmGa赋-4m]l%W?kqaA5:d24_3{d;̒ K=H99n%CgPC#j:W7 3B2Ka P( %9d6']X/  endstream endobj 343 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 345 0 obj << /Length 5182 /Filter /FlateDecode >> stream HWے}g/ ͳW X^1?ً? ضœn`#`a^>;|E8l*lYY s?횘_o{'ݎwR0 *8) IL+yւi-SfrPM)%xZYy>~h y'UCڝ:=0hɆ$~G(F,D">90Trza\ee*$L 0,͠ٲM[j·›#Eϊ$|2yH\eGYJմI>"6pٰJ0edi\A~qP~rԪ ayɮ -exҾxkRiPV6W[p󒯥5@{A; Qy}Hk-Kz3؛~k~o F2N/Ȅܩ#@-De-[s#ג5wAp0hZH碒qS/˳?o .%=)-#AG҄0+^,/FVR5(4+ fA]c)ZG{[g#N}up2 LF6 C[/i7 8ދ(}rGunF6<+< c. ^ SüʒS5(a&Z<gJ|[_GV Š>kuT&y5iwS t_^#ha7[L1 C5mDRE@-z Csaj7 kkܓ ӂ1ܴ/헽G٭A4Q#Ma9d=io|]Ne/*a:Ea25+QRv/}_K.`]'a#U;2ґ㧄zZE F,lYizU}*0@{$r>-U"D^6OKlqGblbS7VY˿!q$ ޴ܓ[J-`:_'ͥ5hn%q s4{AQ.5/K$W `9)LAf;M}/Y1EYJg24Z̓(3`H֝e5ë ̹5lhkٝ3q~BP=İKTubid'˲,-mUG? l]?+m;q"\H/P+7, f> + HӞ?Gðx ˽| :p.4t6dp"wjoYzz8blQ≥rP>u؍b]e;句 j{,]ݨrCͯUU%&.ˈԩ3>K`jfh>r)Vxӑ %Ƕ&!yEŢQ25_Vxf >$؏8dlYE 9c{ti/R<3N*1#5:"[kV <]!]H= r#Л?^Y( rN7E<ˮj0 Ū,a̵:OՙﴙLߋ3WH1w%[ΣAW 'tJa]h{2$ifTV7|P9 cO^dF3 Sq`z1Ǫkιl1rqc/,~κ\BTwE4OkIH%:?pܙ'L ;f+iT+!sa00̘ mOy[v飏$m; j|7`Q òuPOA% [v]B>ENnASWբYx:fŌ`7z/KL tqZssfK ?ݴco>Xij(/rA0@(9sM]g'S^Y,3 KJՕY7A~T#^,hМm6GFcKҀetZfI? Ò z%'!_ZƳ9f_Z㈒9y-0eެM֤.9a`k #3AL\ nVr|G]y>imh5~kf n 7 m{ lQU砼S;. Qeň(צ}U ϸmD\ _ti]ˁs=0vtN5b 1uvmƥSLSgs9 {X;kdܱP̩rV3% a` %uUM IM ]x&lvX pΡV@;pv+/0j4e00 ^pEK统ܿszx_[9f><~$NXPHX,u+fubT5?W{2 kYU\]fogP: Fv>B4 ;|WμC JT~C+ ws[__}}u"B/M!RtдCNgz4F%>*\cB>ų QpKʽSDHߞɦbXrpOUoxt"yLGOHjzY?"z)S"ϘA} cPIPzNn{h{C5ϲxc~OEq,~G( qw3Z8#ަ4ҰQ`xC9 @8]awb|p?!xh*@-JuRtf;r,q š  ZT9Yg(AqضPټ&fdj7|ʹ@n.FGےW[f&rYVNg#fЮ|tt4uM&cd,I?" $hzbgwT#7}f i݄{oi(+|CQhW;[&bE yPGwjhOK_pʑTԥp9ӷ § endstream endobj 346 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F9 54 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 348 0 obj << /Length 4361 /Filter /FlateDecode >> stream HWێ8,YQwe$=i>e,z$ gIɒI4"Xԩ*Z^Es/N#<~E(0-UڍbaCY 06_.w<wgwtǃ 5L*VlwjAы p![{or!qz/wF&3^lL\v>R̋+:ݰ#k5Gj[Ζ=NϦeE6ǝovjx¶'uû"e 4zܵ]bP,M[d/wZK^mcQ>z0ɚ(,KdStKImvծ5Muje>P}lV̴vÊ1\ow:RNcPEGL7i,⯌hkOo5{|! HId^)]~xOn˛QS:2PE!yKZ`%uhPj@Y+,vWE.KִU L4 aLʽ*Z2ߪz riSjۄq a0|M$[l2&j*pp)մ@  ׌3Y4j1ZXH<̲&FP$Y 27==svעLpvO菅:4C.1~#R῝vIq*f%BFu jb y1gw /7 Tb=5 .f9hvYIBK " Ib =UX|Bd׷V z."G]uPekIuCpm841|<^b(SlRu*'+B!»!=hHqL#˲q ހ G/A} hն!`gVQ }cpa>PSSluU,AM%ԻD(*rG !x3ͱݩB V%^i)0 >n%\Ql=E~0Oq+UxWj {I Ǥ54bNjw"ku*p/qxyqz3٫ݲ͙w _M3hOf0u@*qeWP B< S1(Y1ܢI&Fc:>jTeK+:Z=$h1()$KS(:9F^矿UfV=ԷK |%A: %zVY)&t޸!Y#/oVC BT`dĎދXiRnPfF]l&};MD*3ɓjNZ]mPYҀG5Gt=(x:'QJ3;g:wm1(gaUҡ7%1Pkm m^@oՂ`NipO'Jq˶{2z .9UJKF΄|aN۰|TPx FHhͺ+V;>uw %wSRi g.DlEEKJV2aA'-3cP.T;L=n8BI2.f"N4D-/T"CQcm&^tvs@W =pJPIyqX= # LnX'6Sv ̞uDn(¥1hZ[Hdk* MTf'eDՕ>)־Ao0Q^%mQ sqÛeR僜SvldВOY($4_w f+̉kBe5'Y/orPd%]fƵ0[$X u} #J1>n?o&,+ $ e6#dxbQb az_:n [n/X^u ubI䩭`Xd+?2M vgXC谛zQnc|rpب6hew}=T5ٹզ :m]f=0HX/zQ4l [ƪ[ e:lhC?_ 1p:3qayWk%:n chp XU +V0PԻQ^?u0v Ʃl#~4MSJfh] ]$g+(̀ls%o<>(–.SϐHH(ɺHWظ.jEΡ 7g't[P-[HARX>11ہxeϝiۏsGV1Vۮ1/1 Q`j f5@IFMYe)/$k:7'^eLN&=A8PZUY`*Q4p3 kvC<+HnE6pTycF!B:d]Ho4װ>ud53^DhjG{ݴr(~2UaND;ӅMNrL$0螢@J46*Iɮ/VJf}gYeT^NgqC࢈9xwRΖ.fK͝wl*Yr(6ۺ`lY׷PSàM8hμWm;3 pvT)VqWi(87́o ?R khw=ED3^#e~@>ed)6S78-гG읥v?}!q߻ zVKdԁq]n$YJ2҂ep[|חo~b|KZ0 V&wA>y"}Ou3։5AK4ZmLYrAr-u"w4@K%\EjAxKy- Xuv* ZH>bu!rOKkGht@pe#Eh-_11kc @U{Oxrx8Hlø-)jyik8s{gZS~39%@QJתD|g Y)]w`b3v sƵހ"vT5ք9CqH d :e6\(e(O3g> )=vIc -&l$)kf)E&н%:yBS*Ja83Ajj'לGp^a˫sLPE.#i}^+Qz%_#4A> /ExtGState << /GS1 12 0 R >> >> endobj 353 0 obj << /Length 3420 /Filter /FlateDecode >> stream HWێC 6wu& ƃC&=dK5Ejٔd+\'8eHVW:uۇW xU <QIJ8Qa*[P xx& kv#.YfwǸ@wtdJ;Yד 51߰w-A{V'ձV>(k u a| $l S2L,F?MvMeZ5FaW \0Bc֫rh4a[qȪU[W.x Bػ0=3dݫED]?7SJQH7;3a D#i1C3[`sL -ޡ߷vܹ0)$>6n>ljgz8КN7#$ql$a[Y{^z]3!if6-gGvZ4ִN)ܵ ԚJ;J7\#mQR2ִ#D#7_w0F(i壐R.ji< ;KbQ_$yV=.3@Һ{UE؆X.ΥS 2zD6JmSP*N0]R0{R5fi1+gUʆvJs{v?l+g5a~NH`9hpC *A%rʊDE:,HBɯgȠ<4jN~xD/pܠj.? c_7ZZIǔ]>i["ur#1lFc:-#UhoE" {4yٹXA ;mA $cYDK@_,<8Suۋ|^mMKk׮7ݫy;7b|OC:ki{Bf`oŏz]UQwWgL=VX D3GY.3"MRf-o{x.RntMK,o'<#srvdtI(M2vj.rGQA+VT$1OWMP~z'A8A}Sx }'U6 CA 0EK؆a@S`bi 5(Kt@srh|GeNRQޘ nqwZ`vd64;R}1 \{<l 0Gݘci(q`8ᴤ!X=q0(C2 ˪HVaj3XUI6GjC}WTٖKxnj!6&/`|F.@ GX%2,\|E&Jz!sS,v;M3E<)BИwKjHv4L,@ҁ/S;BJʝYms}K/`wMį Ⱥ)nV^f$!urd$Jʻ u8}J+ Y;dt'š;#Z]:\~W +"qL VR*2Pu={,-+O&k?{4ʫ2E[0c_I$ge]m ;`?>@]mcIwRs#Nϊy??~NԖYgL )J?p`PeN@ &^(h=fhh[cJgRUa>G+*+|nve}zˆLj|X zܯ6:h FJa6ER5|d4U2k `~d-"P5֢ʁVɤ$]Q*9lv,av?G endstream endobj 354 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F9 54 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 356 0 obj << /Length 3889 /Filter /FlateDecode >> stream HWێ~lq vQb`3yh=RyѲ)WONu7) :uΩowo,`맻0MTck>hIJ𨖽N3kUT)EUYߩVvtWwƉ [g)ڒ~\,єClu[( hT}r!MSRnOBUk|ޱ {!x}#펉1K~h#*.#E\1ճB YOS})3Vy,Ǡ>jL t03P^^ZΏzl/0ʧE2I,Q͡B;z&資 Y>ōڵlg's]߯ڲSN>\0rRi]J^SwRd?dzvR5`zP>5B:|:@-M3^I&ܓ;`c?,_u "me!07xyw$ds0ls6xYmF^tv]Ȑ6;47MjǠȁcON;Q.tE'{9G#,nB=*z%TY*pD^~[@$ڨFl*NmW%p'" d_K"3@Z0"pjmu6-{`ʾg0 A}4G%O41eAH{#fO][}U~ )C{Η摽9Ffc;/ñAq̌=kڃїKرGp!(KPC})k!z1&I/81P/X>:6ZvJv}0H]Rq<$JH}[ūi J޴i8uK`1ǧ[|NJ9"E3נӑzq: 7"Y ܾ49qTe B^j\K FyI0O4|!yp9q&9<MӲB&3Y4ZȖqQ6ߋ5&Dl+jt^6VtAjV(jy0Qw< ALf%fw=fVKM?)9u ;錣<- ͒Ӯ=Yę+%+E^] gQZ$K#SX! |^DE3fA605~{+./+ U_CqMB[^v+R8;HqkȚRhءpF'Nes1Qq ۝xYN 4/RS:XR}(1'6%Hy[ yV1~huIQ6,W^[%=8?"R|ur@ Q 47!5[zky;=7j{ fՂvGaOs|3HY)\^_12a4醧:#ilU[gɣ$w%d16@\Ttꃂ4FkZz)<қp;[BvlfK WlF{#CK mW.5  ʼn7sf70 @2('JⳌE9VUK{NDxQHnGn^Y7y벎 [5SxbF=t+h7s)vH#yqbʞޫ^<SnáyW?O8t^KڧθЗu2_iB"cǬ(0$Y(+|6f2`9t#$6sAE<ϲ|܈tgc!űUU/=ؗf/Nf4 1FˮlG\OR6ΒNnA v;ݩT|:-DFQjV^,WA C h_kB#K$~08JܢfJ%gvX`(*hpOʐ-XǪ JuK",Sir%t5phYzB0-JvBd Lͽ0[6flncwJJρiִ8tR@S`SSM{Uף4Rh ˼\-~(1'CA̤)ȡC)bK~q^fk?[Wl5$6Mn؋< e+ukJҀR ]z^fV!H[Zҿ&C.M$; =^'Dl@eፚzo%&$:;\'kjD/bOKmjH.6yh y*r]g$l$Nf0Y^1yc~pUde̷ީ=_"l~|1m "ؓ4$Gdl[|ED;#& }Wn6~2"zh"-v=xc%Qaǩ좯پP!E g?F̛$2,bX܄Pi;*ʵ/G搙g,"$c9} J˜;~uG[xov7(M*F!h=qpiqϱ~jjWviӼ2:H\us>QL\NGUk*MɓL0X_0@݉0Ҁ-:}bKÐi{x5QɚSV:_C>v@'y0) CX,vhLR]̀Xn`tT\7`3B'XO!qklotv.$ә?y,!#jSApPlK*\FOg.DP^JSur2Jvxv{md(PZSӟӁ|Sq q;LF_F"R̸aa" LBnPu*܄d7.V,. R7eY1~S5$6̚FyBM'̫sw|('y\ F1&6_-}Hg95\U>%#aMN2z`)sm9n!5.[2,)R_ЬRUWVͿG*7g\ Z MH_ ]>hk#ZyZϕhMƘ` "t:d^{ܽ~ۼ(:[r {.$:|_f$T{Hh%XQ (=7j5b0 σNppC{> /ExtGState << /GS1 12 0 R >> >> endobj 359 0 obj << /Length 3820 /Filter /FlateDecode >> stream HWێF}C?j#ݼk,$8Af?d#$Ƽhy|b/)i&2 xf$9_x9~y0'N=E~x}q8tw|rruj ]ǝ( #v=gcyu<c?4+W]+v+|3rDz$K]>**Tjq-[Ny8} $ Ёd)}5lY:4+TdUٰj?Ymc!l9PMƹkr?ޟQBmN,+JMbNNC{zgsenlO~.';"Vl> ˌdUQZ5]6j[?^c'x|9%hX^ɔ-r%|ϪR7fYu5TMZwﻆSQ{ i\ZV>抅̝$'qP?T;U ÝM.<* Jh\M;Q a3BL" dKcQsBip0VE}*pf7h 1ӛ(DxfQB#;ӈ3 b[7G/%qN͓϶6KK4w=cl,Qff^0'"p{ԕ\µfU=9^䟣b+w@` ̳xFaR v}d'a~SO`dk@&Bv رRcW9do1IYB F]aHܽ#.WxMPYʳuU 0}pM5 x:fVkkN5b֫$ ) ca(KgjAMSJN 4+8iՇ'wb(p5R&[w*]ҘXB7X8 1$(5 đhpdTBϡZ^BՍ-K =pO/L7U[aVɉc0HXBri,*Y#p)?)3㰣Пf9|67Be'S0a`2T@4F An (9agu'0tQ G[Z>ݨͶJB% e48$)$oU+Z.5U=Bس-k 6kd7a!4bf/ 9Ly7;K w8VfD&S9Kgpi%wc;CkPQ>~%yC$f51fG*Gֽy <8f;宼e3&E9VhBafNJTnLpsݱ km@VtD!S䇑v3 HO _y ԊІ\M lemVWeAq輵a@T@c]Ýf`zdi4x۔q7Kͯc(#w#ÅCgEZ^Q^N'vDb ,.t.V /7`4ߍDLEa3$6 0Ӂ|၅ڴ W͢s};p=1σSXR j5ry,B!լi9سȏIN.HK.I9ƬH+d1DFp[<߲fFdD BM($zV7Nlm6UM=T\]9h*fz>?2@q5mZ?"< y9}c<\y#@"n0,3 ]ۥ{M=XP:%jw]A.,CCޜk0qkg*rY(N45ϺcZˬK`=T~KJ BVsd% r2Pt^-EaOXP4evP=ƚR|#%Li+\ol ~$@#%AX!%MB5Veݒh(aUaam}QNYy*q THan!#JB ;)YC6L緰XZ|a-歇(XUEjcس('X(e'ծd'0zZߪwXIiTeq,(~t0 #fTh7F{% ЋCJ (JB"# ɾM1}g库͙ifz=Dwakp=E 엳6}o7uD1'g4jl(ok0|_E/zUt˄#D".Qpƚ/J`]9AgUJM C!HCHK/^i];%078+ndBLz8mێQzgl4I߬k{#h`IoHY`$&UTmleA0OSOusì5Dclr>`X ^n|'&"\w>7.}CXWjz7b/62f8߽EmQ{plu@Ǚ,9&iH>Z|Y>Ct3zLAL@_V*y J(ies]P.Qy.L6 ]e8CZ/a^|b1k7Lp6_[nO*:NL07'im ,S% nNV67StXF5m䳜FY su}273*mGIr g>" 赡t$0谿Qg& @ǜJG8) ;a#4ĩt2ΞrUcnm<ϛ}`0%gZ(P!YMaW}G^8ӓ]YvQ=JYi6ae'֎[z+ؗԤIz3n|cXor۫1txSFu*<fyѽ3$A"Twxp,\z]ugswi9Janܯ1"râJ[iV^f-й1>مu.X6z@8* 8^ AJKoWLrƀZ01ègcKŀ>Щ ̢6þFv:6q8Uyҩ )'yX?lGİ`u.-E%p:(N7{$9Ҍ6G(CRp!) 檎XSYMTKJ*iYLhF`XrL|2 Q3oњ=ً}]IyJ4IfV rEX(5{cX&l P6\q&*tt3~x`CG)Y/,˴} +T3*w"@yh/ґtɋ6P_LXaciyMV i),w<{e*FF0  @/nrM{Z~5(--LgNMo> /ExtGState << /GS1 12 0 R >> >> endobj 362 0 obj << /Length 8987 /Filter /FlateDecode >> stream HW[sJLMDױmξ2"^<&u35yK 1(V9%./G|pw|=&ӯ7IPIs"kUJ%\LZd@"̿8#gP35iaAdHfKz&ϗ 3I0`ĆfZEMmWSA.ҫ<]$%P3UU""u/E25dFTa4~HB t*-Pպ(oINGٖ@,g<|k8RdH^ -QT$D۬NEYIַKS[_JYLZj8{b%u ;ZyZ-A|dg#4$$]2ؔjIvII$Ҭ[T4[ Z*jSovCQ]M ^'Yf`ٻJ˪FޞER)XdRBTs.u=L*]ris DފbMT~BA`]\YquMQ֕.U6s5Hc!l Ȕ&&-I$4I?;i=Ƙ}𠤋rԘ2UQz<;z/zq%$" ca-Ir+m,^D9u; I6H`l]&Ehm$L[(-~yM'Mz.sii慡 ;cc/k"@+rʎGPa #K f/b)t&G^nKR)HҴ3xWz=%8G'Y84C3IN/7GDˏK\0 V' lkzgGqIf&Krrz]R.+7נS B3Ӳ %N̈5E6b߿+eIg^ Lد @#mկ*дmPk`bvhN%oa #}josةUkk;!ʌmc.zy+dݵTE hDHh{wB[k9n[PȶUz_oa$dSTi 44(Ѐrugs +UT:Mg1E.9zaU4][Rߠ ۓ YEY9Ymnt9fcVjʹ H̾N2C 3+3c 'N%bl2Y i?Z-ȉo&>, I- Ք (Rҕ&/'!2͆PCARĀ4\(9C SPq'jzjl (}) no(d6z"POǀ]Yԡd-g)^v>484< "P{_R6YĮF滢6%r.,48RK'HdٰQ0(QRq'pb hPGaJǂ7KiJR2.M=+(V5%D1zcKMOJC}=9L.ƨO12)k{yE9§'S}{TDR/W's+$xу衝T`fa$Rf+eX pHK qV0V ,#agzC(.,Ol8sx5GǣGOhZP>>Lk|tP|HF' L2{ٚ0T><]G?tAs#"VF׿S{;J~18d1.Ds}JP0e1l2b1PPPZ P-Q:.cKPܷƻ}jٚU?: } n]vOAA[C eݿ܏,ٿ66DAĎ1Ar'hIߩC}10]  ߈Λq ͙è-Ug2 ?_jZ1/{_ad"L4aIE* j_&x`J5,L_/Qj :=}4jNohIo˦5XciFH`,Ɔi5j;ƾ:y}(i##"#3zvlaUOGowΒƳڀ 8bx%kd^Bɗ<$OK^L/Eɰ\~_jO?Rˠ>1=1" L"szq IIf@ …G H-QjR o[UJAb!hgl cw[ׄP[a[d0VUl0hV͓%`'0j\tu,5&uwJ X5)]|i*hhC- f"G>,^} /ЯK 3.li<3 ?ܼ3\Y%l{9evK-ـVyLnW=X0&#k/ksE)%DIs?@}KI[R%OmүcEl??_he>}!Z7waJ!N:1 cN=b{ɹl҉%M,h-@k;B+2[瀄sD_h]%|]C!Y`ǹ% \e]jI]ѣv ,`ґbUeDU@ʕ4 S(b>JfUd-IQ$313aejBnAiIL"*2iD&QQݴvQJD쿊n6HR'sa# 趥McXeWuQzԦ113X$AQ3"Y]UDv8!)dEfUD%v W~Qݔ!­:['`]z/Q䇤fkgEҜe'LnkBM/.$f?Qv 2K5YnM#y,]oX"P3)$ Yi[&y862S8jK]=p88660̵uyzn$F&NohZ%jULLWI%f&n]ҦL.qmdMm]bDtU,LVkt'œ:~T$EaN`N./*O1wv=R30SpIyF,2ReljS=/n69o;?kweve*9o_iwe/wd8?ݕp1%?vWƤy+Y+ nǛA{pNJZn8|ǻXr7VNGn]7f=*+ipˍQI]5,kq E )S62຺+]HV1TYޥ,ʒ_=KMG1L;msoN<je,7KRJV"V*kBYS r=DB~^$u7R@ +.) DE8kq3:ELHKpэ@ĭw?j%*ȍo$FwInTwnn Z$ܨ@D%v,pƅ@΂\lչHD+byfBn}=SXr4BtXʪ_|tgco_ O7z7kќlsZw4;ޅX۽Ԇ-xỻ[hzeecCwCNѧݏa{=qax90eA%)LK v=C~H*&=,TR{X$SW59ʲ]Ѣv 0Bf P$0"@ bqbQ!c>Lv<eeE27VGvQiIL"*2iD&YQݔv1ڋ"*2v|3Q 즵iLkL"*Ҧnf%/QQ\miLrIfWUMk pITqQݔR׍%r'^]UDѣaK"D"2[B!Iқ I(]HV1^cUc\qޮg"zTo]:ndUL6G]Dh&7Hn+i[&e862K8ꊶ]=p88jK;quF$"F&N7ɹAp89jK]BVĭtUIЍA|wq9jKf2ɻ j6Ͷavn#Umm0q{[2fo"r2*3Q-l KS`9҂9dULb X281Yڙ;y,2y~ |Lsq'v.xk/inXƛewUvW2(@[A0J+6-'%ݕyh]@ΛQEE_֫7CI] I md.|YRN /Q>u*%Sp3%wAQ g [QV}pD_L571S5=7Lz,j,vt_t9鋂̚DAY=ɝY1 ;;\8j.byF$ϴdӖ6y&U6 z*ͽAM,vu6?H6|[ߋ__#5'59@ W6L- #HMV] k3T"53@X4rBk֕L]ϻRBXW0z~;(R uvUl0հw'u~1L s‘Z;@ؤM<¦zqL 5CIď^ g܄٘ʦ<T;\ &4.ex1Ьo0 ٬/-v>Rhv 8`ރ_%;,?՚fj +n|M{az=Rwټo͵ 4طXVgtm TuBi1SNuQViU O8Rxݾ,>;ڽ} F3N/E`0qL5&7Zr&D(}s& ",/Z0T6o { .0+u|Z>chp,*@ w#K>~)?}^QGpV.$e9S˔ahq>qs'ؔvcҨJ@" HӒ QImKZ Sڒ%]S&m_i _)iYp(7/IM`K J0:I@[ifa@!a6-T6~HBLf݌R㎋_B\lnFSā@\&7ʓZŝ10+j#)/ӣ@T&1#MMlLec+lγZ ,ZZW D0D&dSalj I$0!2q}sUMĖO|#0-6ĬL=PID3D&+5?ZMjd-OEV&yIj))Laj)OWuM)#S0e7CFYrH*Uz9e 2bO)Hi$^KWyY#*ѭ3&#DnSyjxVaF`R|QL ,Jii̤%:!_+ft&ks[NK+`{xa%hdpp&RV5 N j`cv Pc:"8-tiCt/sj| i}:a8oK^΅jXAnp\6)LkJ= .L)Q}('dC]lYjxG5{U~[u߬zb9L'}`^/4SvPb#U}AcƳyJO5Ya.S'~sMױ<9*atruꎇGB'ϫ-L^T6:X{?/`o|E*kvXB Wc[oUoǁC T"iK's ʢ;*afg!~:C\WDzD& LkBdTϝnM 92K}I@qAZQa3:z|KQqIxЃ^=Q&AAQ,=)WK :3bm:'ng&`qz*@n {ųӅ Aw2M@(٧^X+`a&EuXͼx46.4c$uID\#$ƚB$)hUh%Im!` CpUty1vچj02Y`3,jn\EU endstream endobj 363 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R /F12 273 0 R /F13 311 0 R /F17 364 0 R /F19 365 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 367 0 obj << /Length 4779 /Filter /FlateDecode >> stream HWn}*ZsME!ʽNİhrb,꒔l{ߧgvIl(jDΜ9sfr1:/lEo܈{qXܱl-6#Kit۽`%,-h윽[<״kc ,cyYȪdx ZNoy M;طU\у{)hPM[)i &= ~l簉N*R6l&g,ˬKVN*n6k9Yj2/ryLD^8O5@6TǏrIOGp% Bz Zne$SY%{R$QǭY껉qo|*[_@z9C'8tswsG^:q"健QެٴEC,<,8r:8a"iN X>ރ+x =m.l{s!>e{0gad{lbsׂy)' 2զkץk`ƗMJt0^S}gK$x'HY((yA85eiSv(;vX8<NBஏCE2H+1MRr-f}Hߎž}:ڇk;t[1u܋LdEUNߵɊ%enE`Os ܰa c]lщG|O?kBs#26"6 ,yȚ%zt?LE,Ff43?mOhi?tV+fP),{VVuZ'YRUXRonD/DDžH7.19[꬐GkTTBSd jlS(!D_|q]kTe􅸌Q۩,QD=` C#j獿M;E:&zwYZz#Ui,2Ec\!P:iR72OBYbUhׁD6lnm 4EPi[Gm7R%% A/C$ dIjo0Ǡڅ9Eo1#*UEdqiFw UOm1,M\tu?Q=}V3i8A!CtBŕ$heS&Q==M𤨫4]*a{J*(eXi"4F]31I;e ;CYt6O%],+7P24 &}CgPT*%%D$ŰN^+եrO=~`43)p.q` 8En ٍ4[ 5fYt (̲ULf8xE ۚɐˡyqOU/Y[,fvk;ſ˞s8l:F>khkdK S"'lQB*IwRӷe';!#p:9]A}!njv?<ȹ}c!o]%1QhxwP+캻Fmyz r^IbicP.5m)is+$8xt 6 2{033k|][qsac;|?dPOq`SI2]PW] y&ȢYbt7FQ `| 0AZ)0MSv% ih|Ul*fettҴN[P4CݕlZUFgta>Ba7͇۠2MӝT_88&uLg 8PH[M7'=%}גBB-`%GI3WfSYEh2Oi9#S zC޸w[U./l'Y=ϙ?]xml_66uƌRQ ./g0 ӒcN2Y1AY{1!7-\IjՓk 9ժ3FBQ4dL<| Ƶb>~N?.]=hC#t9”җ| ɸ`^{ '~Syy&_JAJ* /~_U1w`x\Ki-s\+eR*Y)B3߲HjE_]$~`]K%"įK 6\Hf 7BvͺYРljN)aK" !;"tѾ"Dwdvאq]06^^ߢak(Zy嶍dHŗNlay:RE"B4$%^Aodέ"%Rl%_ fTYشX~d lz'2UJPUEv?Y!sd5m]ɉ-Zv:d!Y,/jW"a!G]+llsYM;vgr}޻@t$nLFgĤ!M> N|6yBeӕD=^S8}:0;:Q3G2e3xC҄-a^ 0\z~r%}6ƠC! rp|5ny-eJUr+s!TR.`U,0΂z,"sS3f -I )T<_Bܸk&eI-}g#=%)r9^ME\d+ XG0"9kȏ>;|c#PjB E!:~#>Ro#Ѷl rPF'~5=I,- 1yQu⟓?֪D^簘M0Va+SCnyӷGQ!p\ubaU`ׄK3PpD 1z?㸧ݤV]~F:䔵?YFt>]; pyyB$+:YTm;UQ0EﴆYu=4;"O^ҋT]FnW iQS}@*_4% dNJq<Ӕo`1 endstream endobj 368 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F9 54 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 370 0 obj << /Length 472 /Filter /FlateDecode >> stream HM@Owp@fP6(LXN`Hlhg=B#!!/,uuz] @(XA_,JpsPDoBP7eS޴Mr cT}CО8`U|qt `XSy2 *Eь!ZvW?$~.OSl4ZD /lzp6}~XBEs!L~,Ӄ e2b3G\ڇAd(5DT\xPx6KL_Rm_, +8EFrfa1DWt7G.aU('>P_cnѬh%ۂ}e50; /سT>2E ]+^ $@)Ͻ3 ~$E 3[ojӲM>H/i$<$ c{4P\Ygݟ =ɷ endstream endobj 371 0 obj << /ProcSet [/PDF /Text /ImageB ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /XObject << /Im10 372 0 R /Im11 373 0 R >> /ExtGState << /GS1 12 0 R >> /ColorSpace << /Cs14 225 0 R >> >> endobj 375 0 obj << /Length 5659 /Filter /FlateDecode >> stream HWr8-&x_kljĵLAbP/lMJGTM>RBxzRNH}Aȭ~jDLqv:^cnS:qxm|n3S>:>_݈b")ܰ<Č/qv?yB%/+r?gb?lȾ?H<2NDIǫ\ɲ^pGm|4 G꣣0?4ALglYg(:!C2n:BPE񅐥Ȱ`Z M䔌r41M;u[ix+b`ܐodrD G1 \t_aCF^w~4::Qk~6Z@=jji%ƞ5]l 4Z*кT` &bA.D`ϻ/ <:0.ڭϱ2k:TS8Qe (x#r!^¸ v`[2.>o(ʁFRZU: D0ǺJ%gNLI[q]hnDV)VrUމv)"'W(f;, Fr OO~*WR)q_wL3PɆ?'B,&Чgٟmۍ62D,7ꞗAСKvk;q67(*ѺZ<r+ntMKHb:jn zml}r/~fb9Zn =]RlB Km~ag䤔|CkֿԼxJ1pK2Z=$=oR̷0mQd"Gޭ$0;܈G pUdK*z%9!3DJt3ioݓ6 w5O* 8z)1l$,eJh_}#Xxm s r ЛXu[w)!5uGPIc"`ORLXVz`3^,_i| 4x&\YVCcF_vqN9h쎗sQ<Avp\I)-*ǓjJHa~ <' c5(1 ZJ]fxF2YT̺ On/84 v/SǠɽC.Y5"ȕr;65p7s)Cxmi޾``Y'f2~ܠ49 ؄zd!`ӌp i;&R@ /Sc`q'}!>g9llG3->J? bU1:0aJMdn}g+Cwr N-?*Ґ`cg@FݰyFZG jU^l)c-JVD5ɚ+<+ m߇Y ΔktgA|JU(IҧW(uzo:=I9 `N@!W">Js|>u۫ڙ:DtVKFhX0UɈ7!Sձ"wlOJ^Cw&g(7ܪ0an\.%8/-;7=֞Y 6\Z7 Mr SzeTʦ_3͡z[%`@}DZ13>p/䳳0쓯B@ػ鮏qvm|)u`wGRƖ"Ӎ(u0 ntphXbG[w3:e=`JjW0A\l_Ÿ'+zǘa;Ea}n;xUZo[ϖ?U6E _iVڰ=it_JTI$L4EҎ)24|Ȝ")A"sb 1Ƶڰ'Bypڶu>k薥)]o) Ӄu%q)y;\*Dٖ},X(\{y`š-v9ך̓%k'U@3A !ٳ@-JLMvr `fdήe"W2uuF|"0˨/'ڍP":uTR\N[U_̯X^$p=ޣ'/TFڡH;^v Kw|jQxMTqYU7 /1ǂciCh Vy8h˞DKP_cR3:T9P )3l pO"\lq=P:au[A=eMucbϓTeY#,(&4 <`L~ٕW2WM>5-DHydqaɩ<(z%]EoȔ+kVom5Zt5vM sa+2|sMt^53Zϙx]ZKΤQc)&w֘9A"rAnnb}X.؛vU B ?<)Ir}} ` !؁;*R%̌v$Z-hYigށ3ӱa#a=߫Y5FRriW̃ 3m7tO"Wtdv_!ɺf#x;@zPZj'"Qa@\o43wa(TM) M4yY% 0A%٦1/Q.qPi;yo)ŇZte:$oSč%+ ",-^me5e73ATYj^|lܸEX'I!p8 1^|_܀DLEڼU_2f\___$#Ǥ]+|Zo~[?]嶿?J6c,z'W4>:YyóX88ђ*Nҷ@,~zwQFϙHT"EI0k{ ï xgN2׮>/*Z={*E o,{*M Nʥ3U6DWw6ˇaqLKM039PВ<][*{bOg^m]ݴǂ5٠vܒE%/,;XGjvivaY~ X#jjU&3)f;"UD0 $׵m-@) X@m᧏$GI=)E|W;b<'쟣1) wYE]MhGXR+dlEqy|xS'zN+wь 9'2HVI4g='eX]iB˟vmܮ:ݲ@%J_C"d Mҡ]݊'-8Wy9s@VV{OaW>m$䙄gi)v6MkF WЮt֩i[aD'y,k1~2Auu-rƷ=+.E&Qo8c#5ƺB$Dg@g/q~]9ơT=9zX,u$e6ZUsK iWYk&y~*v;gI>z=$)66!x5ޫ> m]We?RCMjbȯ.%SC/ ʮ '!Ԇ't=>$9J5 ~ Q}$Hi$fH!FAO.YH5u(.=A05+!l5HrB>SО ^fL{.I3#Q Ʌ.E%8ńn6 Ɩ.C+4[6 ~IN` ``߷֕ptw X$Ή0D1٪<.K/b1.Ns ˃-4HXp)wQOWuEFHLg^>WcGߴhoך[_+iwU̡,xwnĩo-W &:b _JѼ!eɄDD(f)ۢdkb{RQ rAc0ދ09ɐ,ݟ 2"z7S3_Yk: 6aL[y.J#K+z =}HTD7YFqP wI& HnT$O֖k|ֈѬf" =nS AKg&P"F J euz/rkY3 ;xKw|joҩ5Q4ǷNh6}+24dh"Sگ}Ќh`X>M-e͙3͛ʪkւ2=-P>l]Ɨ8~3R)x#& "fp닊h|I%XdN\*%{~B)E/P#TFI1$=&aԤ[͋)V+SS{#bԘ 5T 7L > /ExtGState << /GS1 12 0 R >> >> endobj 378 0 obj << /Length 3479 /Filter /FlateDecode >> stream HWr8)!~$k2IBE~ eRl%5I*Q,l86d0 !gفLjӑ]I%~2_&e6^L([ȌR[Q(_7Gߑwzgjv{{|=qe{K& )ODr-՘L$ʰ: }ݸY90o:^QeKMQBnr QP1C1(7BFj0D֎\},qڊ[}k X<`P-U2dR'Y-V5,5з8#w2zfA3qgp\H<:^}LZ.H`Vo M" mLe_]AFqJ><{PylC_zP; yaUOB.Er/q63>y" S&ʼJbTUb]RQ#29Jd(crk/Xд+)>Tk6 Ь)°\WiZeMSHg}F?#_;>+@M%Qn!tR[S^ lYFو^67z?7aNOQVL.(L aJB͗Z~ pG\w%8jJL}&q/;%Y,O~ҔEI,'@>oۢm-VK뺋y&\7$lK9%7JxlT*IsmwQGvS~]/UԾ^;Tǣ@ҟm1'[6k ie_cbۃiؔgK'^pл1RhUWiWUjy;:÷~Y+uZI WA6*0V(i% I pv/ 23H 4 Yъ'3*E^2JFk~"T!]X3CMV2"wh%PLgm#:\GjS:w)+gCDF,7X:tE´Mäv#=nЈgר,~nq-<łOariǁ:u h^KcbfpAȟ晪?6lrL~)wIkjL<~n\Gr('|Njť+_ͭl'sHPj+$%Ts{Gk eс‡o_B J}Aĭ(# sEMvʆF4^`!cc(U#NĹӼB VWl2-xާOO2U*HKCqLA,B,Viu4eAOxlrFL0ts޸RR+Z`dNDH5 9k#*>r%XOo"nT|!J!r} 5[4&g\$b"|NUØJ莮#W.Zɥvq^6iQ~]`یai*Dԝ1 }n>=G1fj۩_1hMhm/$n|V, N؁՜R$wmd(~8tx朥TV Nu" "t?c[AQfF"&8M**BMd-̩ yV>"nc݇_ EͶ5jn;|߭=]$Q$&K5szm H)=yq NCB3&\ϨzXdP&u\?Fx^٪q uv- JB%T[fY3c̬;fBz嬚|CkOS fh {]2&ekm\+7c'cIVz[ ax+ܵ|OB4\,Z/L'Fd@|+6RūĀpM Jfom@袈6W=1!alVGfTC/8.UMd;q$ႋZڤ V[|R3zZ9^l=d&ڹq'!Z .=l2;Fj(Rrol>Cg!K&νQ'i5p|Bϊw)ܾޙԙL>.`"Wm|=sG)}qzxoQϢ)5Cv'i YcV:>Sx_ rkqȥ% cb<@\@-CNCKz,J{W Iveeͫv 4Tkuɹu1m msC 'RАD }1˙DqLTrYlZ!=dwo?`r endstream endobj 379 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 381 0 obj << /Length 4695 /Filter /FlateDecode >> stream HWrRreډ7Ve3Jyg@Vwf(ON,\V%h4N>woElX,˲dia&E?~A߄An{_)ZEIPi]iI}sgvLQ ЂuK ϳEAAKaK 7?_$]1,HbE\IU%.#).$2Wko߿wv5O2KuTJ/{޲/cIeIXǷ?e}@AFDi&E4(QW{}[թy^NujޜyՅ}r~ݙ {߫lfpK6"H,FUQyrЙ: ])s_I;iP&E2+Rvx/띠StHq,oָY c4{k#l+궧[_W9mAVH uZ9̢$s5hV{RkvQ0@Zrӌ< :@TmtVkxRq+}[UJv\G;ѧ[IzebFqX٘Em@" Ag;NaЛiZfZ!֩v6R颦.VZ|zP4;wNJXp=M]+:n(bخ2w+!AL? m͹FEmU4ljfa 9tYOy!G؄|&jhLe7ȕNX@5f9 utPI3~1蛹paD ^)w %{$\ڃ /CzښVjƱ(NhQp\@ܠA5%B:uG{FNAkur{+G1l(AT7*;^\p$PuEtgR*B|Sːu:unEp; 9m|az%>GTm橷(v®(J ^a)\Utg';.WIn9zuh&z8ѩ(,3g%x$ ZY"tW]`EVIe.C]i]%D>2,|Qh1/spStھĚT[W?"5-2y\~tT~:u6gJ|uwYTDu攽ђV+vYo~]vi{t-9˂ϝЃY :]ZI/ h` ipy]Xg’چ݁7W]Y"i&'9l$uKؐ#mΰ9Je bwXV#FN'xV*V 5 5?[nB#|]"1ۦ:;qmȱh1QG)./_R*j=~GP;y=溱 Ks]8i]ZALŢqKJ'{%OWoWQ6X+f#͜JN=Fذ !1-Z`l(<'YTو*ZfN*{yKp:,l׹6ٸqZ As 1a"sT"z??̖vCG>H>dXD%ʓ^%7خ_{Id6L@Z8ݐZ;}:>pJ_MdIzfP³PDXxD7Mp 섷8Q)$I&3 Dwvbɕ۲L4nla.t(矗V,i'V;X5n؄ avᜫB^5iXOqf`蕽m+R_\cXí1yk_$⥯|n IRյ骁ˎңe?Uy79mCrE< sGHP`D@b6^ ލ8߱(2->_Y2B{[%:Ncb9K4ZNj4V Xhf|D~Uߚxp#LzlzYÜ,C;2dr>"5';x,vLwԦT?'.ջlMGmDLY+ئC 8q^YlDwHt-d=EVμxBAҩ"&V6ѹK$l׳Lgԉo^jU 9+;ЉmEHKKQ^9%z#2s cF v"QtNZJ?cojH7M^7}(Crd350 Dr6/.t6%֮&zyG]FԀsAeNy-0d/aVT,gXs7/m="CF"ʎ<]E1q5xj].ye.wo91Z\$4hQ4Eᴃ\y`6B^\qO q<ḽ㑗O bڥ%Y 5_CoJ)JgKlϫџ/,-2!_M*+-񼰈F;ĺ5Νf!)Xw{׋ΠfwNaR>삁[goݱD証]9V65P $%R`뇦|8=:8uѬY9hkDGM/ouy 1{BF[]w\]ԃeM@k)z#tW}8cLTj#ćȏM_{L-0tr|$c\ %̀oEA?O .+ZJ}5$3uTGAnŠM{h*l,vpU֎kC_.v&+Iރs-ۚ%#q S Wz~ Bj2i~hl^B;܃#aGu|xr~_Js+fmu,=V0eW\ɬ$]MDyіXYG۹':ZW|!cp)&T˓nZ]ೋrK(uXN!+_d3&X˷JyݫP_GFT@0^庇 <Аl{'ΓF*anC\r6|C^DؤTs"LR| nj6Hm %" %J;54K"aAhjC xT#GN6@ƫty*<5#MgS/^\tƛ`x.L/;b.ǫ2[_Z^p $B77GymӗXq #f /,7dSƕjJd\KR J~vćK=!N8c?H}O 1oJ- uz$ GkE˩;T&(v_?=Oa endstream endobj 382 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 384 0 obj << /Length 4677 /Filter /FlateDecode >> stream HWr<)*Ep_@/)Il$[%1VRapwD,fv!3\,m9}g/ޅ YSx "Hr$]0dg/~/e 绳WV44L5nL-,mb7?8yΞ_̡ Ui;M'- .LD ,2.{WM[YM+d+-wz *dm}/*l+Z%=wL֪TnA[i^_y0\VVVv;)֭$v\ nPFNAa- m5i{:!֛FUkLqvE,= R쏂Wwoդ7_<NB&~kF]yCzoe%r)`D7 XĎޏgn/#sܕXԶTw{0xƀ*Y{od\Xnn%ghFz{]'ۆIT ʵ SV`w]CS+Fc[(;[ w[Yv>7ځWw+f 7;#ɽɆS F}=j³&1fZ ݣi7?p0t+z퉭 )&^JGHQr9w)jQ`f5RgG|傥޸gx0>,*g?QG,j 7 NăcI>C ?8yXiou6,uY87[)^{h1;f8+hH(O׹SDiHt\ЮT-1^4E]?~:%{޴Z-,J4F[[U> q{Dۇ9 e޹f2 BWzKDs~-c}%rLDrc W\< I8P_ f/QX^a0,3:UrMPR77!lN.Ofr,2\b$rB$m%I2Hx\H/kb"iq<;nrisZme8:8;@-#1r>5:b>J1u5b>gḥ(~;w޿doUR4V_{G > UD 0G 5ɲ FN gf,Og%?9=l$'/$^eZ{{p{$m{?4:| |ůS8u4K3*|tVŃ]eRXe)f!(~ī&fybZT?,]㕝:B9g!C ^DRړm$pKw:yeɊ'͋Ns2E4yr-t̋iѲ*n7Zs`+N26F/+ 'q׌{`P =l0|ΆAÐc[Έ=KebK4IGCx_y(E*FAWĪ(JȵZWء9Ņl^ `%8[/?^:Z$mo%N=!IΖ,RhQM18 `Z;* [lNi6z{ݽ-gi9~nP"Cuhlpo>5C!z lbےT7F蒮TVsE9R,nl\rT7G"U7A텄ta' '$}&~"/Q@g D =?{B >Asp8`MhLcqv(~5%~ !Zd*68s XI"q*. >L3ɮ DAǫXO7l [ņy]lɟLRѐf>5)eƶb[3VѥĺonŜ0F;uFtc̔DN}"=^l% x#NO=}/ޛI9*%bGZcܣr`ǍYQҨL'.|8 )kɾ롩D UYҏKVŻxIp̅0=' W~W(s |GKbvf|-߿-+ɝ Ѿ#d;7_Fy'ǥ(r_d&U_qE IW`p!!/H&`.UG-n iU18TAlkݮtrGּ$_<2P>9 ;2镤86ub8tj,poXЯ9~dV͗6M-L-[ȍ)mhs?HlϦ8`(jSR7гY.}-|,70.%Y-LdhC= mמ8k2Ncc(ࢋ |(![u+?V_*_H18PX@U_4K^\ttس29X4|fԢؿoh~SťS /RwNm\HAC[s[ŘtqN"J{w 3i]*U#mV—9bKX{#?>%蕢X?x`ٟ?fʹ^[H19:.ko.3ưO8*ӓo4 g'4\ACװmDtP%Tޓ.WxP> /ExtGState << /GS1 12 0 R >> >> endobj 389 0 obj << /Length 4857 /Filter /FlateDecode >> stream HWrsx.XV(`diyK?تvjWZ˵0{0blY6OI0H6a_BY{R! ia36A!̬(p mylNT{kUe@Pؗ 1oAȂMDgB9/Ƕּ8xɀk@syC.֣O?D[fr&l* (N6Y@Qj?-So+V-K@ su}h\=eBViD'`ڥYT*Mڽ"rQd#7((݄&Q`m-o[+BӼ މ9D^Fjl:Ԭwmyѹ'0ds 񝌈QlbT=jVaM u yvjڨ,{*^ /uu#AN3vepe g6AЩ뾣7]-K Ӱ$ ) 09fmzF ʀD3aQzj%X,)d?քg$h1=o_ug>‰L^ m3nn޾_|sG'h>36 ۃ%==wpwGE,B~w~i%~ym_B2^SqvEgW_]s47=xoAd췙^c ڸ?=EeF#Q{cjvV3/ \2M'UU`?bip'r,Xd=qkԯEq/-o rL޵/S :j+ ]FCɾuֲM԰o\[z8F-[Ž6_o-eA [fK*3 Pea?i;n ?|VcA JoHȍ_:R8'-[>0 *Qi  h@f|5THM߽bc/A1 uQ«L?cȏs G~BvoE^w%b*=x֍ $ t+OC ]5>ڨLPFlلIaqҋw]M08⊳eƄd/|Tōc'm=bFi<7+j:SA.(wy ?y4?1CTBq|evEFۓ;ERwғeh0vmն5$̗a8mu Z8ѰXu_XOZ8.Gԅ4;[ 'ؑӬmo2LUUivTGF^9\.l=YKfvK6R?;*4IY.NgK>՜,a<ϳJ% %.e(}2|h|OBvYqZdu2r^x:k>V5UݗЙ%aرd}® (zvnvJTu;b5`m)r5S-kQ_/ʾz|4HDjދθ48= ʗ&kn!-R[&b,V*4wpbDHVtBS1 Ұ^Xl NM`2-!YCNHI y=|ȫml^LtG4knbyqX48Y:K5 o wFzҡtfoڙS#ʌ?3Q u<0H?&q#'H2@?10dMjS$&%kN >yUM6%ED5^J>[u+rX` ^Ld.Α),-QŖM \zڟکL LZlo,js*쑌 ҖB^ #jI#'RjZ*@" H‰W\ f;$ڮI!' 7uRpИVt0p(@{R-4OD⼟QJKB*9nn %)\!B[R xQ)ptGR.;2q{T\㙨L .6 0ۍ?^ !Ph[qVvVsٺ㦦qLcs%$ U^ 0&@{%J¼8R lkY# )0!bA& 8}CJuڿ$R,r'67ɐI@J|S t2ܩ=$M0O5d$užZ2*+M4h$7+X7䉾w.@ IR:YTQj]ӇU4j,Ieqyc݄YEuDּ,"%TnA߃BR Cq'֢W꧓UPy|61 ؖL_LyAnn9}_|Uzb yEl EK?DqD_ \.]qJ& lvA3M)2<h; "{.J}ź0Vѣ>Zė1>ju2yyW zSڧR7gǠ(cg qQjO/L9Dz/W'k.ړ:ao)PN9 ~)ҴCWR+5{#e'2\1؝Ȼm<>l<]>HjA¼0ٽ#j^c& _2Uh~LݹT 5L}BHIfbd \`PQe-h:&=evF^IJPZ68&!/Ann&w'y_{V-P7( /ِ5plYCa36/Uk?DQصZ  g~\$YH.5}u)M0=\I <:[Z+&ūᩫtؖҭ)ERB7dc$̱H| I2wk,2z M_]斳C|PiZu,ql#je2!Mnz&dC&4&/MLc}{Isq٤Ǐ%^M_=+C{"5_L6_a']YZ``ZHѭy` >:V)Q~oSXz3{6b:؀zmהi+'ny(Jee#\& ~:$~x1t&<: TuòH566cxJo/5\N#ꤐpoeDSjlD#^Aꨶe{1!]^RVȩ2R&apb0`q>7 VaAwC<+дkE} bA N,&i~cUCkӂ+2Û (a|LN9楮ͫ.˃M6'"Ka8ǽ&7*b;c"܋Ociwr`dg,c}a+6lף;FDӭSXÓ7yX1pǙ x V37 0细 endstream endobj 390 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 392 0 obj << /Length 1867 /Filter /FlateDecode >> stream HWrR!x_,>Kn6)`(XDDAYD.nIvS">}dqyIF< >I”za3Y|3"?{<8;9=_*ȊLUQЂyANP%D 'Ff62˨d!X\~% ȧ^Fdh/< 홠3,ja핱Cxih3mֲҪ;7 ,Jȃj+oxI.D#ꍬxhL01c .8ܺ"QW+2%ĕyJ9W)v#GȈQ6lXJ,e }D4͆Ɍ6PjIǮ56ĠI] &hf*ԶFl#laa  сTXjmICX}X| IQrU4m |,DaBA|GZb $ u}E%\8_ !8@^"(g6s^KڅaRT}\QY@oG2WP2k@G_f~soVȂen>?75?F% F K #-3t Ҩww>Q|lׄ cnUpCc,9h'G7yvbq⓸˹3 A"nT,,,1$NŎ/A}jJriXJ$K{VzNOKcǿ &"!ZAk"TGR)"%I꼭uR~@̥rQ@ C1h{3cSAqXDzB= =Bawj' iض&dM{^6_ǯpLv)z|!ƩiV.et |_yꄶJPޮ(U@#h5Y Wն Au_'0a0{zصY6 eH"7hV8Qא@u@0kF(\B}I1ʥ(}m܄jn\q1:75n}{ Z(m'i7k%kM@ԗ YrOLȼ(@3>,rf4J 8)Paȍ\.EETmU2c;KaQYH@V,$Nw=i>1n&s=>rP&,Y}(,5h`?Yr/CaF,jUIBCߌ-v8Ő endstream endobj 393 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 395 0 obj << /Length 4397 /Filter /FlateDecode >> stream HWr<);Փdٱ7^y#q7IyCrVI*3,+)lW˳ rs`>,X'^9C/-3x>=3,xv5Z "/Jq67GbBh&kZպDn)vd(4̺VzQZ Lh@ZK)]A.o cfm6i4(HXPĐƤɞ5{/{四SK$O2=uTw53jiC8\@V} QnL/Qid1VAxI32nƧckfogqBv_c%5aX[Nem]FO[,Ƚ?aE):vaڀ+ʰ^Qb[ /t#!.?ʅ',S 0ZpcMa Gh xi(6aGb9x  L%KSeEt:KB0.c)G6kwg٫=7*3kr+ŵmp$%+vG+&(Bk"&M؋ƾ]<`cRxmeoDQ`qΚc0 >PQȣ{[XJ &RZ2avSa!r=4eN@z uh}dZŲ,lMs+79ʬހrE}j'tmiR4}#bCS_BTF}Q\OC~;vE5ۊw7t^esdyM+Zs"' 9_!j\nq*q~@Y?}rA ".V6(| =qP{^O̵JlijӸ*cC3&͆>ȸ}PZn.ZДܪ!1W΀T7nnye+D|c1JUU&j0'v2HG@zy?5܎RU(>>obSj+XV\#S<,uR` 4Qy߽ln :ghqW,dƱiEy/ϼhIĸ*Eж$#yمR/[cYS/)x NXͰI}P!%Eu|i; D-p O.~m sn"pA:qv!3luKf"Ohmو2j:w>_F1TUw_t=*E'/%LSTJ.A7׶^h!۳ŎXgc-y?D6:PhsKՌCYoF?4_'&tgS4˻( '_~ -BE.m1l=M+V֬7kEcj)9ڮoo, 5Q-shf܁eFRz7b$X`Xawɝt@O686`l^I +_-0(I_*54؂]c#ȊE*H AWЅڜH|)9yPk|IlVH4fGBۀN5q#(|/{p> U,uqm.e拹=ENTZְnQ5-(i7p *C3{r'~DV9%fD͇B~Pǘ6+B1u$ ]0`w@*s;95%Zz\8 5gG %3E?&š SM|<~_C endstream endobj 396 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 398 0 obj << /Length 4491 /Filter /FlateDecode >> stream HWے۸"+z:Ԯ@ 2s .JINjQjY- 9M_Tٳ\5_r}Q+^~?t;x)a6[ՓQ1zA KP C ۭ;یBszU=j;8Բ"Q$:?LS (48s>Fd3 E.cO;wOvGn?IEZTySe}״xhVx_+G^=*t -Ee~Iae􊽓գ} 7>-Wt'T WtN&:Ouc7lAxhn09IiM(Çl tT]хl4;ulDíBtƢ7?/sgTwJ˝DzOk.LZHpPZp .9jv\S"wnz8L\G~#f,)-0eXX{ĘIt_gѝi_ 8G&!H[?7hĐv`4Ӽ,sMƫR7ȱSj6⯼k.63b6bVG( "BY5,utDzȏkPǜͮYf` oFZdr H3 $H,z|@&>Pq[jJd;tH_ Pݜ*JA2i&Fbq~/A&w Ѩ-ԚkPyŋ%q!~``A>*-v p<ؓq KʈIV>>%1U$e5rߩCH5@YLQNbifʙ>),W̹r72jԎhn^kA6 o4( +ANr#9ЎwA6pM:.k$wߢemѩ3~$ ^u 0- 4AnDFkj>4YƮn i:ʢX AX߽?dCBc.hG7vhw[&?sʀ|{?lf91jk?iLT{J>nc8LWg-^~dWy3 8Pe^ DTFE=i>[hoJ~xNl)ڼ bu+VyI07\P&ڌz dHw(6y- Fm@si^$Wl.tuK5Q`t3琏J@]p|fz%{o uِ`&|&Ѥ|DSR.j]t\><+4}EG ~ww[{ 4ΚƘAE<1!}{Ws&nx"t3E15kEлIS"]͂kѭVHNDzIʃ14/ώ.Cf4U j΂tQ$+jSXS#̨;:H.:Yy.R-Z`>4.K:G::sEmت~ L:,;ȁ~ ͋B+~P`7_䷩Ҡ,K:ؒ_.tZqT<7V\QTeŅ 7;Zl;vck||egM'hfTN?e>soKlx/тh$V:l maCZvs($*100r*W[D^{AJRߒ8SAEjJHЗIb'C;vӬ=c'x~wE&kwgMT,DI~;5MP?pIz_Q۠2 Ѳ:R0Ƨ4>W œը = vO^M"x}\XEG?'(:"ߨzTC o(\M)sf1tP4X c0 \V^H(Hvjeq۰:5T2\RAr2A@e=fj@@viGݎ 0PG@sꏎ*Ϯq`ޅ<~ls"燇?U࿈mCH{C|D0Ѿ^DIh N &˽r: vOPe2Yv^ZS>+`mdvW~/SH0=zӴޢ_%~agHK顪%O (_Y-RI d05P۹7뫕\ ДctCμx=3fu`N#PF#˺ ~p) |3 7;4=YB mfi 9<s7:3gRd-օ˹!DSIK? ӑvDC_d9u{[K zXO1AB?(A?NEc?mp%`^߃ r'DcRj c3 pwzc./4o _qK} FL-<x+p,v5W &Hd^,E?taٜ =(6I~]1.SX?M(x 2Э'@ ^D )QO'V`5kj\}&{SB&Ch`/r=H7t*A$)4z l)ߟ Ȇlpd $%t toOϿl~zj{K.$ZOH$DGy7*–5lFEMd_4 C(Ie(A#ď[n=%"dM)ښRVFTl O4gMڶ*1 o2*GړtqZQp[[/o%=CG&ӯ9cN,[H)+B>h@?chjĖkEF-sKT~_;d1zVSR{B yJAC"ݚcxaҥCCl?[;kqZMkum)laz!xA.,-luj]rïo!m dXJJzo7qAmEӵ 1 z?}MCWJizXZj竜1Cvv9;4qͤݝ!Xwga~}ISEd. h Kti\c|4>xy[&*h{'"R>M*Gh{|H=qn=?@N2-w<㛬wX&{[d3_%ޚyLDaA(An'#~gʒ{3i-ٰZW0, endstream endobj 399 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 401 0 obj << /Length 5198 /Filter /FlateDecode >> stream HWr<.S"4ԓUbr}/|?㿜Ea(BDlqϞN;qۥ{Q@n^&){Ywd{>>T;AZu~dJs-_='

KC7OpӘ{Kw|(dK v0ɩ4ԩBlO)ǁ+PMKv>H|^ g;p~#2UfrzuR-^5Ikx2ϑJEOܷ&jI^֦H]3[<YI\s/ȳu}@%sr_ 4GRKH F-KsbP#<,EEdp-jT-z/q'٦^4]Uý0t>34njlRb8ԋxCɪrښFEA në̲BHӃ3;v} ;җ<\\i(r' ];@[wݳ,LoǗ)QoZIճ3}(&q;Vv=i m婖Β#Р؜gww*3ȾvZ-mv|5}N=::RidS}QYV搿Gnꖾ4V\TIRBT $mOR0I[t3۩%!,v5do |M6"W ޽Hs s(w hK=,K3 #vyuًTQO_"-iP]LCݵ tFƂfs4YReV܌vèIj&=P7fo4;ZayA: Ų-Yս2=bG:l"/ן%r+/d4Cߪޖ}_*nh}vM]cd}&L[ڡ0R'{7S4̭LM 2;j6$>Ѯ;SM5kr<ը-Fϖ-J9?ota7+-t5KIfKw<n]_{n ×h2~(.v Q<š~omOr&v$G05[7\3`th~l/Gc5{m &f97O=3LȈ2.G, ,+~I2T./-p [ܟf(D W 4~d8a;ō3DFI^qw3ĝ頠+n^tlt'n͐ Tm)כƏlnI?CYƒnĂ<27w9K2O\mXp>{!o=@͚W>5tnPjfp/ tpbb쓹Gtѥ{huZӋka=nGP Mb**_?j%^BX@qJKta_;K[.g&'0}ZHd]nhU0ԲW|0`}HnUފ&UF?t:(xn}փ8JWN?L\ĹX,Z¸xRJ j0 tOq̠4 &)Fa`)YG0^ Pnרv EI3wsʳ419o 9ó>)',s@N'حXUC>X"ze.oLEhMcGjaZF#"ټ 7)cAѵw5{*e&[\pQf4>#U" 0 ǣJQU ti{!A7 ҍpIpo7q,8mUa,: 7 f@X|nyXJ8i/&u]K^DYޕ#AOԏSDt+e<%>*D?ҭ(I? R<%ơkxƍ\/?p@H oZ+NR2@,j6W&s-Ev=<M?NCN'؃Qu%O-P9)O& 5{1Cz|=14.lFLӘO\$GZEZs(ȍ9EX[W>=t`bǣ6#¹zǦý8HAQHTiʉOAT(._̨P}{i;My09#hx}I8<\-SLq^i҂ϓ8\P)3VY'~WɸJQO@*·)x$Hѧ,蝕(%Ahԕ 7.: I̵vޢ8X]"-ta y"SjM!q|͙=}32ޤ%ƫ+{VrO`P!t+SkIoZc)_{n'|"=Y/cxPT~}U0- ϻ%6c[x`}CkNy.Fii s4#0?]M Jvu $ߓn^i5Yҭ1MonU@?ߓ 6"q;xxh="l:|`zt5%h?`e%0ޢwS=̲*Cl^/Ԯ|NGsrOu ҞB.0Xl:*lĪd6CM#aΧlcþ ϤG$yt}Eky{=ٟ4=yl6K< WV`p-{غq?*$dIWu=': CD#қFVBSS ;^OJ(Alo):sZԬLBU(N9uFg_]ٜ<1sI Z=VNb[2AjUz3NnJZ+a.-;c:OǏOƅJ{{ΒqhZ[ez["hE(Ƌzxa`Rڥjv6Sxl،Zv/a6"앜EۂS _ʾq#OG* كK%ACڰi< 99Ldϸ:EpudZPݗou5ʢ*v7 2i nP˖V&ZhU T/Zsk5.I])ڣ%qΗB6i蟆-*j!S-̈́QcJlznT3/>& YX+hL(w6$iϒd;jTcl>F^E%MN dgyKL,SwG]"h-cV0$$\5SOeyd`zmOԀa/Xϗd7_Vz\}> /ExtGState << /GS1 12 0 R >> >> endobj 404 0 obj << /Length 3276 /Filter /FlateDecode >> stream HWks6yGBiO:4I6fdq?@,1H+ʯIl&3 Eqι/o`-n'137 ^ą:lQ%[WxH&sؾL/W*OtҜ}_U%* ~(2b9cgt'˘;aū9 }=ElG\C؜*Vo4_jW)],*Yf[.R3Ųrt`s!B70g[]fe5&\%wL+VL'xkX" ֟5&t\,rFk_j;]rv)a[e*N 1^zjo+p [*Ĩso{g"T2-Y`lf͘k>cN&uQƱ`۴ޘUyG/3>6pOKrjVܲ@|F0+Y!,k4AD DaeOQ4iclI6=2CMB %]m)AE(ulb3c5I Qr+b[Z+}ʔ|jOAaam5Zl&Ll1!PT2 lH:kiR}vВ@ ,=QjHȏ1jֶڐ,e8&wX}[4@. Hw{]&:}Ыa3h2z .5UdMSz2>x 4NprW p-$ELeP^R V:I  \QgLϪTRdr {=PI@sUeQ`$3͌N:7ٞ ( ]&+ Ujk؅_8%К}TƑ7]'^yYQK7C Q vW N(AU9;$plͲGVhvҮwjBXxqY[!1Vo) ϨgI.DDAt.(KPiq, ">c+>F+Ia7oq\̱g!F]cTɃF^,/є }6)(_Zk++u )9{|:93ij%EQCզhqٴ "c4PMjo{|$Iǭ# îu.5 BCԘ)~*]-Rm槶 tADYV56}QU; }B$fyfLA5zs6H;e-A)̄nbFj.An*WWTw4Im5 '>fk>c9nl{x[0v.{joϮ-+3ӠUӴbټ(S@4q%uS&jM]lƐǐDI܌˗o_q^>N2<=ԇ᾿\76#E O?3<ȯwo&l"X(dIzr1+]'nI[z]b:Q̦7ceT7-yxpMPWLm~ y)>G׿=7XG";=J9n}X;p;eDtA*GWRP$1[ݗ5fQfdғw3_w!ff.s9@cu1eX̏DAUiM -u_442u5#5s|<һAo@#q/A#׽^fKe..`&1et"#»4weZmre'q98jtnl[VH`%}2*DoS;AA/$[ u&9c̠ŋ eGܸ,vhytn1*qjܟ $mX,%]_|8C 406U)L>/Zv/~q7ݱZȤUdb0t1uby^"V>K6'&$j!KsRg~C4~&f8e/ɊJC*03ڊ.~hӕ?29'L#Z%pz~P94ݽ9{脥7>Z IxAd_- c(5Fʳ*7un~ÕX);\ۊ-GC(nĿ(m usOra-F7S8Ć{U bhE{@~1]K`~觩bOѠdi6⡙[P(].[ gL;EFJ-db0P^#vt+4>Xm Z&1N6'ج~'UI{/}zy n(&W40$A ;oF k.Sʈ^-;jP /+@TUnU,<4C" 4s8%tc_ [>%*G|*K$Ij5 (nç!,Xou31g\ slgo4W>S0X NjT7#^w6h\Nƥދ*?/èAcq8%t[#v!,Y#G3:#'ѮզyDE6+WxLgbxD/5^M< :<GӋ~Xe*L|Mw ܭqSX." V|@>ѢLG<6I{jjbBuQ%(fĬJ ՜m #]Ѕ!\1q[q9-BJ}6eIW&}eZ]#5r Mr 96Dׯ&@GDWK|⎉k-;y(Yڱ[,3H.[c8i(IGvc^ƣP ^!-ȪQwECE@%K *E}ywl9 F2t.<v!*fٷ+B6[ϐӄ._L1.A8{W,Po9P endstream endobj 405 0 obj << /ProcSet [/PDF /Text ] /Font << /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 407 0 obj << /Length 3638 /Filter /FlateDecode >> stream HW]w۸}l_h{N6{zZIhPWw$ mnbB̽;JED#5Gs 9aMb_.).`e:Lahz?9%zN_AR8e ?NNdU, Z/9=Gne+LWE^?M]od5K3I^>T~dbϤBx#Qٸ<}i6OOI7) Uz|-oYi<¯AkVckwqٺ2[Qz[Nj x ,bBعFk¢?)ZD_ӈ<^ iC=pՑ`JdU5pfg7ez-Y*M$`HxU1SOf54*F8Ε2 XRevxb]ӟ'gcn-uH5ENkAsx4-lU\EXRȭhH4%0Լ,hT.n VrD#ӮeLʴ&%2]@lMGWXd&(X+/ЋnIv2ۀ&L M2ؖCQr?tŴ*r}l-&V ;y.24],RI6 1 @}:VmaJZ7(sGNy ΀cY2e}S-G>&16RWyN`,3߂gbzi~Qһ8;mz[nʶ:Dz%ge;$3wAt8֞119oYnhjo!EDTJGءcÜ6lՃi8h؈ht|.%oAv-D(İKd03tB8Ns ;ӱX r8A|Ext1?A}+q;c3h'7{,̈QݎCiDQ⢂:z߰\wD 01W=*p:_Wڬ#~<֕??ףA.`5DX :9(UPA>Z>/U27_SsSdBöeM"QOy$dL^$#ЯTP%1(h Qvvp|WwQG}S\;jP>x1H$Up| o>plO?^ZǓqVܫ;Vu2rꬷ8"(YQ-kɚ]5ȣdM2Kz0|FUC9xC(zlOx::jx)|ԋgdĴyfyX| yfucPO=>{ TA3c#};cXeE)UѯxUBC#e}Eߏfu4cqg[Q='Q)BTOɯ[_q: [QRY :t;6;ty#CԘokK_+}OzVzwPa|oпPiyИҞG=#<<mxĨ[:яg~ruh)pLfO*@~1>9*o?NI,ocWFbjyG)͎ɯ24@1_ 12)mɿ C?E~ ychLZN"q#l R‚5fYaAuZgDRc#Bki8#Bdc^h4;#͖H$)0ֈ[h;v3(Bv fGcRHqg[B ~qc]hvE&x DYk-[^v[h\N19N^hкb*O{@0o4eK}NV#XiZsSn3ޤEW|!!dU~KmR]E[r6^"^E5JKF[ϭl5˷t„)cMz CѵK#cߒ,AҢ1Jvil(Qv >V1?.oWk ջ=~:\]ڝ T% `H"D~ 9:%tsy-/Dz<.m 9f.+&S_64/?vi ȭJ?cc^Dc"! 2SX͉@R;|_G4 9g&KobōԹv,V2ʵ>ܮWO'*V޹iNr54yF>\x(, Vx§ӭmnu"aBU4v@a2AɊ lAaa\a}ln#!~t , $S`j}M endstream endobj 408 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 410 0 obj << /Length 4621 /Filter /FlateDecode >> stream HWےy\HATUr㔵<̂Crи,EetUH==9BawK2Y:RI qn?އjn^?ݿ>23*04FA}[+\||^l,>tZomO:jWe]cxΜGHiR087:GSg>65U=SMʑ)/VKH٘O%bngQmv:k 1:t˱+2\qdM=S[mk$-[I\Hji $Z\EGniS9l%@+<]6 ]PWtr];'#@p .iyuy{T'K9#~{#v3ú\U_Y"p,^UG~`( "ht#-}g+QRΙrXڑɈd_<}+j,ji=*xoPFDwDrÛӜ QI\ҏn-##@aq!y1dޟ La/&6_|WNg5vܲ8w.\g ">=LzMN(>#E plpMLQ=rADwAiagiN/DISd$XT/#HQVus p=kgMA wz`^BIE2 $M[bB,ZAX1 "rc_)@\Yf,z_P4S몴'U/H7[urAybЌY3{3U2Uu8v/haI=ϽgB$0 ק1A@^3f6bK*u(_RΨDlϟVxa|3UqHd,d6\'%=Rk@Ȼ<={-wB=+{ݦ(;c[ցP@A7qRd|!/Z^{dxjE+)1P_V-M[g]fԙ@3J_/F@S (c4>B YXZ|Z6vfnO#Ri+ (4b@bkl/U\#,fխBꇛ, _աm C=q-E|OIIE~SoHXOk5ls$GԨd9E\lLli([C5R H##, (ux ^0 ,"#s o ~B:4|7 =e!"G @iv<2=تhf)k5~ " ӄ,3ag#l<:*庪-Kύ!1@ūmlTnnon>2Q-߃9 a~Ϡׯιv?S\;w˯]!?HT{zcMYjUD"MRrK\:qtM+9Xӣ7 붆 `z^ J:2﹓=8ꣂ`uvyi8E8F$ߪͨKNj:[\D#I,PCJ0C+z"pbN]軡Ĉ7dg34u|vw~ ׆9"zzPPOU^wi~-p%eNϋ/ġ< Wu37]5LN:RO3yߋWeAB A+IFh&Wcݓ!a}Rܶo΃K+-YAH9%uZL|A13Qy1[;2=1Eݫi e}Bkh,_i|?Zx v"ѹSӓ곹|ZX$CBH7O1L>ZVuS i(?%yΪ}Rfx51ő{OMw7\'`ܜ6OU^Og|rUW 0 endstream endobj 411 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 413 0 obj << /Length 4118 /Filter /FlateDecode >> stream HWnHC?-< #I,;k0ED)M#lEIN0(R>uTU?}rQB?y$cM]]?8d)cz4%oGQL>P N͂0/kVXs|mѬIQu5)y9YaU7&֬l=yġqI0V/ uKY g|mrj'Kq}O/)q$o˚K]* g[VB6Edjź(hQ꒕$c ӯS.QZss 6Ћ,P;#E|J @O'1 x\4b Cb]rKMIT/Db :T+ki3o$va8@%xB ? U{s_yYt5 i!y=inod&2^R||S5th-Y\47NiF3V?*@7=Ǿ8 `EiZHCwVulZ+ˇxy|&yuBWiφkb~l߆ʫgkYQɜYwVȶW"A 6ۻs^*6 6} Ad*JVfV1FtT~l4X?4}ӸoX( }H-\7^thڴm)̰}Fqs4D]LjP$&j}pb8F~' m}Kݚ: F(r ^yݲzt‰nY-x_?+wsdutز&A :mՔNM69**fֱx06R,rš[CiFȪ-}~|`/5L'CkYHe R29{-ȴpLOF.P{cF9RkV9?5>)Rf &4'ҫ)S폾5k>);)JGTѡP%#]z>+ɿAw܎!-~) LmjɅc֦Upf6`Y$D{.t^!h?*|x#&rkE٧X{ Am-lt-2]Ԟ 9,R6+f ѻh)@(ŋm袙c@1p a i{fj2Kl ,XBlb.AR{ízaLdBOx݈FogyC`aXBw|CtJ{+T $ ?[PL'8ǰ{c;]6Lh h޵M&cE )D'+!p@urSuC4 \""%̞t=avsQW/E c+RF9C(tg֦׆WjSD Krs؛ž$-EvMkz'`JZMlO nT^J!K0zd?~XVп;NsQ9SP@:> ?D/֙Byv0X]B(:~ٛ?]~Wrx%u}mc7D/`CbuKݘ)OkCHYE%[j8IC5@()o䄄V N2zCD1{E~**LbrP7,$:P_.\ձ!wC23 OJqK%O{M++[Xӱt8nB"jQ7 CH|eå-~׊286Ag]: P:3ãDaƭNJfej@rME.غ; w{M^/w+uQmh?nq OwUbUmow Z[% IK6]v93pk2@mîІ~9/_ Zث% z83=n^e5*dڑDg(\@c. ⍭.`G\ {&ApL`D i7FgH{s1u2fRh,qܹ`԰`- fLٌe2r]P3pGCɥy Ea԰V*6ڒݑT (&z^>,trߢd8gXli뮪; mԇaGrFWOs =p]o? "%G/%6(,tG^cimyX[2/ޢ:kF駃E 1?h 굍¥+4ʨ&#Geb]a)UE 7k0Sg6,v9ŧ1y mAX0޾eD~ֿC|f@cFX 5UI֣OD3~X p5cb7+ }-Uojem(FpT*L5X GA{d-4 W'V`:K0M'בf6Mݻm׻:o֨~'̽rI*+!!NOՑ\V/Wlz)=5)@_$nu3/~v_HHJVPMS/1%U)o u0ixq{$Q{w 0d}z endstream endobj 414 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 416 0 obj << /Length 1350 /Filter /FlateDecode >> stream Hr6@ﰗJGDri&iHZBM*HU}.RG+M;MJo[(~Rq$ X|5FqXd}ٲ*l.L [^ aw85E88zU){&\EQzhmn v^b96hVT!h \}i*WצRْ]etgh&QyA:Rmm&֙w:SbDYlm\ʼnϰx4nh!T][CftC/h|fp$Ʉk^ItÌw_ SIIˍIr'qu_Fu9RRgMzs5n)iUl*(м@E}P;gIDڻzdz`٥h*dm-qɏmKkA2؝rFw:Xfcڥzf=pGN{Š/o5h+ۢO3U+J;͸7|nw숞Zxs;Bi=+L[tDZr%q>`;K IBkz f)gHuK;?3SAQ0e~}N"6 $O8ܮ-\9ql.<_G=8{UCD] Ed{8a1_ <>M(úx8 n6eut`I}.spvݿxR3:wP7v߲3|;D)nNJ(Bk="y5MeT05h/ mTֆ~2  wMZ k~UNidK&p t>, WV+k4fk-~YU+{UFgimJ_D|[./]#`kd]lJgk.'2'_M'gõ7'#s{Yƣ0h>baq˶T`3 endstream endobj 417 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 420 0 obj << /Length 4059 /Filter /FlateDecode >> stream HWے۸<K"QxTZW2yHHB$YNR@3މlt>}滷3ۛwŒ"(XDElg7߽QK.l}-WQGi\fZ+}'і2ղukFQZ)L@yXK6QljA_Ϻ,g pt('>ۄ-xIUKdo[YvLo{m{٨0;1V͗xLHuGkUzK9ܿgw??}Hg[īͣH9%CQ_NKX%;"/,Ww:(J#E'+5azN ,9ԌR7 زۏz#Mg5b*bw!"ؠ,V8JX%KXAJvGۨhw!߽X)Q[ ]cFkhUcPԘ< NRot=CxHX},\@Gi:<>{gDu{1IwFzAxje1q^E,u 0ejD24uGvm{Pu&9H|*/l _lh[it6CVwvu+]ĉW]t>8k]Ð/<_zJ߉OZR\Im0E]E&[&- ::-"N0'@;]e%EC-v 8]~܋(/+IR)7>СD$"+s); ]GaQOևF 0,A kC[J03kRIRԣ5IRT6#^%2@סZ;2yb (f#/ (:<2튿D^">t;k*ĶuojJ59&ߺ 8ʺ7N9*ZNEPo]ȽIYPH^}zzZXbMߴd^k;(ߊ贲򴺝zQ2gي3oD*d`;j#̣}):Z(S:s\7qr@3v!OIF"9=W5`'[iVN;vE7zB{{ 3VUt)Ͽv}z . cCIO8Vc?~ZKa\%N54)^2 +3ʲCGa$Yk E7b (O}/ H4Ǫ$Ykx-O|ZesA3;;ۨCȨo|Rrc;*^TO;J'蕮mNӗə yv'w6ptkV*\taaCU6LhKE`sb{i&"=Xʭ̻z#\7WhTW#;;eRXwii(D \&Y%c%%(xIZ~g+%߲~ |(q2X>U%;j=-!:+u!^`'#]䗃!ЀN6n3ӆzEI& rndS@ͧ]W 8($vi|t(3֏aoz2b,*`UTRYLjJ+[0.4׽ɡ7%8e;/ A/(ch@w!c$/X$ p zÂSƳ T4p-uuT<̖cr64v+EeD!\ 1}Ƣ'͹*n%?I?>AkLY u\2~32/6;t@xMT6$ԩYp] 9o 4-Dn.W0-ZԱ|Weܩ5吷Kئ0~:kĆW}pch7bS8U9Z0t^ZB$K{bW0Sݜ!K3atUa=ݩ^] ؘ8#_Dfz$P}TUTtS$7& |N``Dx[#_8!dY]Ϸ e3ѾZ J+'D-zд v ]HYi-]SBK>l5[1jcDT[Yh m !U94 ELgTKV@OtUU-?15S2т8'J{u;ߙS7#iv&>oZ+;oGt\^YX~ABRY^#*k ΓV=cˮwC,] 3 aGsqj;5]6՚Zo+CoO-?kI>E{v[yqBu`벱fUћMiGd8:u-*:'py)_ҽQóR0<^V$ otNN/jtM$)p=zw6 $!뗜bQjsnɸ%<]KU44) G-Dѯ  `?S |\1e{4zpt;1el1ih;q|CNAvpŗZ_r+2/t$O+/OwGƒ endstream endobj 421 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 423 0 obj << /Length 4974 /Filter /FlateDecode >> stream HWr8)!+&[[l%/0IH( vCH%[NM%T$ѧgӓEM'"/ 7 q51yEL븮 W%žI'(Msޭ>Hxci~ -K`s]H7gm0=K*j%'4]ѣ34w}+d Y;ZoX3C0@i-R&嬏OѽY!>bi M4過蝱BA<nEd_'KML7װv.(@T=APjocVO;aƐ lT\хf9ڹijOיǥTPO\{_rL|0tBE..0nMϠ.t^m6%ϸ5xK258UGS҈1^vG0Ԃ˔+4sh1+Qp1^G %0ٌ'_}>[Zދ(Op)=0ڲpXB`'r4c{+їe;w@vl_p=@dK> ,uc#@vbۆ`t=`WUkf.ʗ&.h7MYu t3Ы;^8qx-,Wv ۟I!"Wb]$T|Co2W=rav$BkLiEN<VФekN`࢝>Vzz,`/0>o`w*sT,e'Qng<(@`|CkhmAwct5ĪLEu..LmR7lOoq]Z? WU d OSjA$gaFJx+Un;>x>Fv3Rcj45V26H{Oj5VcϗR$m~C kw+d .&les]7 }n6_ ?6ZF.!U&,Г=pƖ'qDsae_Kr3\0kx>O[C#A@J_k@#au a4v=~}b jUtﳪFP-KbFPe$-yՠAJ7*YW[>r๎#X![/λR;z$;7^emX 4C+ҥVIMռ,L.vsg"Rj^RI$=S"!u?W5ϟ  T9BZxr_چ 8i\6/6QV?wyrSIz:?P"24 ϵSS\P O<@=3@%\Z. QzP_;K>Bƀ>@!4_^?J-B]H(!YH~FrtiHh-gw*L UQKL5xyY㒉@1HX|̡CIpt`IuɸyD+I  CwbMsJ6_dg7{_+!E8o^GEW ƹ۠%fZ_EG˸NM(-VpF/|XڌQ]zpwhDT ٘rg;s<gN2gNP"ޤ}Or?sǂG /D'_cvp^ >zDt⛮3V8z)d*jt`HKgd,:cAj\KQ>4& e#0]I]|ߌe}0UQ gǴ) %rؤ"/n_n*|"# -Jm ;Jݢݦ _j|8@/ &n~k>`&_*Z&DKT9̲e 8SEd8u cdldn`ouG_fE ci+O#9I|% G8+IBD+ 4 1E6Yj a |8TMC6JiB0*l=r<0l&,"'څ"&܌gewDʝjR(E9TskD_iQwGNS!o+>kz/Vj<{-: 򩮐2N_UvGII% M[boH {"Y/!at-$@H.H8zd^frMJ<(>˛zTѕUq`!<%[6≡85iN][,պTi¸k̅wF33Z'UʅnZ3$j~ҵu( K_O-͗ɣg^yдBվ=4}!8~_VD&;j/@Ɨ~zew9Ӑ'.? endstream endobj 424 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 426 0 obj << /Length 4312 /Filter /FlateDecode >> stream HWvۺyR$Kr&6I)B i{PeCd ޳gAv:+ ADAQx/_ίMH2/(TT f#fU0bע^-ĺy'GAɆv˻ /[ Uլ|ˮz_ޔi1YAx:$ 7hW|xfS50i`M->Gȱ4Oд8X;o֢> 1g_emB၆VU#(^0^0H!\uA~Q,(uD b=vg?I kŪ /#V1ՕЌ?Xj۵eBXͨ0 {BëHSܔ;@'6ksʡ#Z[ ȽJ-/LjP(QNM~ mn})qQԬ2JY-ꂯuRx$ vA`]9 }=tI\Ip%J,jLRc&L@bd ījR!ȔV}K|:[P ?j͹oo,D*ޙ_ ._V$Ier( oBB LAP0 T|ƘJ?4^Z- c^l9Bym:ډd\et@OP$80P I8I*R] /E;CtMMլl^1-/NP|i@Hw ьRh DHng谅c|F1I ⲺRwE,K먛k ƨkGjH={˶􀛃M)JG-F40SRKOe!OJ>J~JpG`]z> /L Ǯor~==6lރ3gz9*Ί?P) ?ziD OǖV2 fHhf};4-o:?*q'Jt0(Фr/\T6XƄםj)mjaK(;NdMW.$H.cdm"F+ b4oR,+eVLBYcȺ4j9O?)n%J$o1;o'ga8gljGJ}Ie,;a{^Zc"ׂߏ;ljNˇ6p@1EYmD]N:K11;5@('\tvu}&5gCJ将H;ng0P=K4SzR#X͝ qSNHcg|!@T'G3˳=cBܳZp,S/ {]L"@zE4ir^0*%s4c絀 _ I7|4ӂ[iCpXh.iʖu8 F}<ט"oEkj9>0g>68B|2f>ogFQ MEw TZzxC)lF~y#ITMH6;DQ9VK}/cvr|mB"Gk=sHngoRl1a/M$868 sj}mi< X*.6Nh pqnT+ӧl3WێG& LC ~SzN@g_7̚*^AjUhp;\"J#S;X[˲co51Y٦</4S^Q":$d5;rhs_?'U~U3< B_45}zHOWMCm!]A0be]UT5:BO&}:LɋՙDPz]ݴ2 r0T*ȣ ӹcG؈]cCMhӨ速b/ Xsilg8>ؑ= p `3-!k68XV`IѤ=p} $>PkWbܢ?NմMH('UN)={V9dH8aF^{R>,L; sRU3} I IL'":bϝJ%@VO>zU\ڃaژ U"Uj(H{ExF 6ٙGI+#8 i:}IA( (by#-AJ0}:zU _ ^"<\YF^`ʊo35'EĦEL{/K^ɿJGjۮ4m;Ta{SѳPw&ѩt”g <%OXFRh>1YQ6GZ>^|5t-^gr.&i 6_F9rhc\ϧT@SQ/&3T/ϐGNC)fGӢōC% x_KXrы1g;2 ɫl&'AZB3[sY,R< !fsGߝBBSlNBb׃k<[ \*&W60[ fΛ,A`V 7( Zc&.=bdL  %Ն^ޙ^26ʲ+E|AL,1[$Q#~5jd'xd)LB23)σ-IhtiY҃J)f;0 {q'֣.HӦC(Gaadki^xgBvtYuGCUpa,W7~>;5&K7wj j :jj[.頵 :&MI\J(k!?ry/3K, ޯy 9w5 endstream endobj 427 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 429 0 obj << /Length 4183 /Filter /FlateDecode >> stream HWrF<[$o,;VDeqFyCp BZd@NV"9}wo9lHEeǡ"?l?rj{a{ YK۲mWٞh,uU6Vh {*ўrć˗,y[:V/NkGoj|5L|މem>R W,QMxZR-vr-&md^΋idd6O݈F~k7eMGOFV%۪`I~qmuv ;l*Dɇ`VaUk$lE18ui kaje Uv@l/9 ie*w5{.(4PUQkz~hRb?*J9tFFWg@{Q>^  8eQ5 (أ`[I"O,FmW^LL Ybu|8{ʠ. B>M-^VE!reDؾ&Nv5jL0KOTRͮ*աtSWL5FuSJG8ޓH]lwNopDũl̗o\]pa+Nڶ|ᓋǑ9swFo}} T9ӂϑ.^XV=70Mf5U}5GiEcp,h.p ob:#,{WR5o1WNAT3u6ˤ&N<8htw^1g۠ŨֲdME gWխ1K-!ҎJQ6:qܪޡjj)fsӶ\? LyW𶪟Bk7]Moa E?4 LsB-΍@o$W˲e#'2ɦ%fz ֎nxsD]cro U^?~ZZ^D}It($L0_^O(KVLU&;/lR,Nh9rϬ\<>{ 7^?Z iq;g=/]!`#sE:I~HcGq`VW*bfߑ1<oF3#AiRd[^Dۣnt~PPaWm ^{2Fj>dv|D7ga[ד흁 \<"jXP }Lt?Y^e`hsExjL/l2Fxn-@ikFbįdXZ).?:^(lCR.k(g!WJH?}a7HifOuK/ĆI i00i}G{-RٌL0#$b#B|3;ɥ$E|S=+ M?J# 5Q.t7xDse19-E-I[o:&9XDoٕ~1A׼nU]NI8FdJP,-muYJ's۳ɌǼH=,zu(f UV5~.壨1TUKBL`/Ԏ^pT.0Nk`Z7TӶ Ijڵj[$ N5((/ѕOTc9B%'noڭZmN1j]!^'4jjtB-A]NY_5Q{v7Q"u#T;|*!G!|+YP:P2'=$)Y5 ]3v͖>h=g@|5 e:)hC +aT'GCj O&oLQ%⑎e/BAҷh6734yƇ%zkT S2C &Gm>LQ|6հ\Ka嘤`Z6,TGT|5M2Gj{n9IԻ(YYèYRcaSňRWi4O*"cE%AܗEyXbo)TZ{B'T*}|QaqgdwtgH6 { ru0Qi:ߌoE6J!b`H!4 ht5K 5xJ9}Ó Fxj?b]'ʥ ?3WAnYEBh Iv@VX+ijEP`XqU8-k3ӒNJd֭_xP`U)Apy'3T\=|/%I- h>h䝃!#'A^^I/ /Ed3(ܒ;=*RuZSf+3E#Ozesy4vYF.(U}:תf@E8c!s"9ݬ{k Ը68JN_ ܷh,Ҧ"r0 ؘƶ`l!j}ܘXI ?0vDOŗ '9&mDS3QKD{g@8v*+ ;0SGA|(*LV~ U0׫! kį㺂"~uYVvCFc*s Pdp(:Vp5(cq²Q/  < >)rw1=X&JAu"S}U++TjОFZBTZ LĞ60M0g}%-\ωs//h_jU'Yjj ؁e'O9{yrTQwy*= j87+KQwAՔXWڥ)}#ל/ѝ<+ƩaRMaŕ{i"39,#8SP7G|g +$JdTQ n8F5YH*fk C!$mM~t tj $~F$$_{sT;w2 p%1]pT_VYOǾbKdӳ+J'*ևcݎH 4t!Qsoj"0."~TV$S)9%BőYLDA::0ZrqywyD +U'/:"W0-=Ya2 9{`BkC^Uù(S%nVN@7_K1yvb<6%?53&ܭ lSo^BNf$o~ϻc > /ExtGState << /GS1 12 0 R >> >> endobj 432 0 obj << /Length 4368 /Filter /FlateDecode >> stream HWr< 7ț;\f*IEyrV hW)ie}90V7XO.nVHW1 lon{%>)jYZ=Vzȶk-ĻREƚNuBRU[ɢa_TdQ͓Z3=X) #xgd}tGi:guFtk#{2L-lk׍F| M(.]̣'MS :$`O<׾Jzت(x,/C'a@[i$m;mei;;ԥrAᓈ7j_Z?ضQj,,g%AeUlv>h#MѪ щU_1w}}|ԝhcrC;[#lJ09Su-DWE#) {h9!9(d{t5V5iK;yH ЪF,BT!Z٫i!У9^RT ݋N¢rݶ~AMQ^f0旼_Р-"l+sceTux -K42z'N,sjkW OVE -g$%ޔf;Du:؄WNGz M_yV΃Z[L'+E^ EAIU/b9ιg#3x72&:`0gJ, 4 L3(-^{pY{ERD?x22bs('nmELv?)&nb˾ `4 >0V39 Wkf"^%#䋐0^ZxW;٘`+HW dJQ4_Kfn3&8ڞd>eᜑ7Z6gSY\`}ݜMf_49<E㌔ƥ$%dk7'm1= !_uMAFrTԆB9H9|}ϟCƴǁJVneRE`G\E_Mmt7Mm'p+ngI~ֻjDIfq"*/+==J~̖ %N~reM|zao7jEWs㤻dJsU$t Hԕ_g'&tavu{:Ўt3Μ8cMuqOam#|t/eҭ۴%-RDEyGZ3ymbmB/;G0yv\,`s:_ ޫY_QF"R848PWMgoi.ǻɫ[ Ue`\~P5$E*[)h-$4Ħ"V@WG#"E-~yfܕ)!zo(_C@1YaY߽q8zǀ ;>I`':#X/n׮rBSCkЂ fpd@ píJ?ڑa#=Wj#¤dF"S ٪v 0x^>S4HBwD(`'>H ukf #Inr'^æ/5 (f?1\`&dջ3ר#c zRq^ X-Xg 9dy/IVLnHGidžp\a;Ӽgc &BFpk%t\95d7L/}掊(-pEߛCnwz;ִfFP@?J,Hq&2CNpPFb5s]#_.~gzh\ 90%r2\KG?-. /5ؙ4,ӓ1o6W݂y|*SwƹBg}<,J{4 ^s*_Ϋfm#?߁B(zsBbZZl%Q%(cYrIJCvggJÉ]McA iKA[Z+aZ]<<KBe EX;an[ ŢsO.eb[`gNņK䏰AG JNќ@0y7^(vSb)a9L&}i$2L!﶐N'{'*HljnVf 3|Pb~f|@VƸx~oD~KѶb: we͹qB1S$vYT[ȁmVe8E[\mШ)ᯬRG)R,ѯy3o߅~uǗ$SÊ|@wWcX` *;wZW Tc Rxҧg>ԍ !,=S~* :b7B h:=?8ZLR+PRqwfjӤB3-mWEbm`ϨC+[#Gc8Gp[l5\,3\4/!&Rj;ʦѥV׳= 3s yݜ8y>b_Z #%.+a-RGu$_6$G&{z!GɈ?OgWHr} Dنf+!up;2b_xLӋ<ɂp) ^cj}Ty0 RّgCmBT'm]!W 6--J&hKH!Rhn6:4H" 3#Vx$o /NI O_NFYFy,XXqžߌı+󃮏/G@ط uQjBq@{诞{u9sb<frMӤ|P>(<[J7r_5O ({HNvK4'‡ѭZ(ʭ0 qn8ò: ԏVs9X}9?5Dao3/ml6$ow Ι Ӭ ??\#P Y`XPc3Lp4Q|?:ӨsYE4p>K|D)xpEY11:*w$ΌLe]3j_hY*E-a#!񲡗1؇B%k`_1oJq uH+mɆ>G!:`c °;;B"| 3"K 2pq>! N38z>uĎlQ28Py{U endstream endobj 433 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 435 0 obj << /Length 4810 /Filter /FlateDecode >> stream HWrۺ~IMJ:m$S Vtum@YIG}]{텻A\_ǿEAE8r?Nrwg{zǀm+}?cϖ~􇹃(J,AzqH/ۇ?qe2Cb@izQJ4}xSB]]˶55mO;ַ ml6%ŏ°xAR ㏢i`a]kݰύNGr𮓢'@WyaC 6 `ŏ (s25Auˇ?g(:U-[ݾUk𩖥PZ ~]Fzh!ė{E͙b"#=^k1Xh/X B9le-F"kjT>L3_4$Nl%`lM7hvа߆X%UH!}}Mjvb: F-(DF;zp 9c3>.`uĪ*xli,*ԓ=Ac@qmi9o{8F|Dzƙ58OqTb؊,~a6g?ZbX#JHM\A+,yX`FB t7Utp%J},ӺaD&wQۺh/y̕eH,M;v6iARo0I(@xrs,COpF+5?ў[`9[ <I%!>^ - IW Mi\MN*}22> 3 c "y0^DO͞gihY.e Wkj(A plr Շ#Rhzkkp-|?^Glc ;L@Kj$?g+j躻XS}",rݿĠ<mq4>9ZG,A(ߖAc/.3pv 7gi/oiAa{7Suk A/ 5v"fZ @8wCO!ȕuvձp fFd_p^$Vjv&"Ɩ kX]v#zKJ nIw3]1BX}s͐֙Tb&*IGƴ׭នh2ȍG  G@ச[G"4ș$DUj?λihܛ"ϲ@ͳEzy?1;VovG0voH~n6^_bQ4D"v߁sO6rQ%m}&$%M\K@Ӵ]v6R:OתC~ e{Y ''5f:, 3)z4,7H2Җ{ Z2"Iv%CtD:$akN*xl|_,O؎zV7#KQYXIdų6HWC={%n/RT{YX{6SF;GԂl,fDy aInB/jlZZ\*Gfuy][h)9[fP??ju_?xyW `t~KKo2;7:us_1(f_yt[$5?6,WWy$Hq_E JF~Ѓt3z֡0c7pFklz<&2:qg8cw Gh Wnt>!)[Q5(aF7і|uBfŇ u/7z8*^ tuw닖 ~lADMlx{ڠJdEOkz J†[. AуCS+B =; :q@%hrunL{wQL}z h$98#:YpӶ.N֍XqKd7~v( Uݩ`m,DܡՄfJ _I\RAI'+Oe{Udk 5a!Kȝ-X۽-m #C/jO-v3خZ4_.pW]] Aw@lS (}{e [Rom$-G!Ǔr:֏TL8$x] o̍KsL<%{PXbQכ;.Y}2ȺZJlUAI ԓ\#yP{k`, BX9Ys[CE2;u=cS#t;ʐeiFo+Ey3&%l5qjeQjx/n-E̻(Fޛ@PCJ$x 5Rܜ%'OYe۩K?_>$qWG /? E}D[XĩOp`JpIΛN83A{NVrGbcgڲ;β"UW0mɽHN}c'xQFNF8eExf; nVV*ft˛=3$؉?(1270 (%.drk[ͩJBG h5C?b#,Tw&aO?#h\l|S y-|֟Dچ^JE@hXOY(S>%ӥ6TC=J3`'ؓh'%B]Sٽg5ȑrB5 "]Qp Vh0/otԟƝ9Fw/M)@$jv]S/gK*ւc< G i8e՚_߈1cshi_`,d 3<`4wf e܎P k/Lm!NYvHK3 mmJ*\bCC*+#c x`"r[ߍ=8h3FdsJx l:*s)ȣT񗺏lJ fg;v/lFݶn'KwQ?g!L@u5cFsih+@V奡Zp! |0WyjsOy(/@ uZE"f_05 3puϬcǙS&/(\_w/-Gv=jU7RwÉ)q+WT'Ezhu3,Lb6) a\F7[*܆0PﵻVE D=Jۉ0< ړ@埣^?lPV*-~?4 endstream endobj 436 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 438 0 obj << /Length 3245 /Filter /FlateDecode >> stream HWrF˖%_&Rbg!c̀==3 Jtӯ׫WaBެJ_ɒO8fyRq%lݮ[Ⱦ^xADl(2]Z #nF\e/_\lT$MjBU=*}bO[Ymհ57dTx5bB-˜׽Q&Vf_Ѣ/XzӶWrվ͉r1nCUIE8h](G8]b F2,@DC`DMma`gJxOTʼ-f6S5d/mt xJDeqT0. :PF6=77!%<2흲qX[QKDnl6uޱkZR)X0¶_cl_LQyЃ_El<bʬM3zQGq#;ć^ةQ֨^!n7P/+-M{M5 i꼶E㳟'[-160ijTŢ $xd؅iP axt9_ avV)5G MZ!,,;j@/ҳM;]5b(;<ݾGiWzU-[GF۩ -ޤ (VG(N@]ĮPG: /sreal U2rynCm=Nϝy12=T]?W3 /R=Ny 1r]*T&v!殕7/=b2>NHߑ_>C^pFm:F-nnOo1-|&h b$ 8mJ%LhWNݰ?lj$XmI;Yj 㣽e[U_crup\f}7˺Eӕ-Ύz1co* 9@iLX Q0|5@o Mڊރ R l;ުpAe?eV  @'(?'oz0g?{|0^OTVB&ʓ&+X옵Yݭ^YF%L"WpPFw胎}lK/LAoK¸x}q , ^zeL_\e?qUyJ2EB_.*xXX {,zsre[wXxțݹSi\/5\HRz]ƙ_`R ^fڎ6cQmc[[jeen|-hhC0,wP&uZaz:kV)pjTn" `W\P4W\+*y!MqYBv^%yK$.e|+B `91#y$Rql[dR 9xv8.=l, 7w^j{vPL}]{2xG66y׾-OV ^]YV18Ad?ar`| p OWn1 -dTpR)rqc0 Q/O\j8cH=]AϽޟ;~XTn`O_pl2/*xȄU#ШpMs.3z0=zU_u!EW`轅3I;l{ ) 퇯bƓrW;)q=ŁC]2%x(}M& !BU_Y%*bZD>l r)9]PN*^ZKNCią]10/7o2PT@W@%ħ3P pzs{mIbL@dt+ iu(^g7A-`aaJ CeΨ1e Z|99wa1ߏM 2e>X-+K&.?u 2Jhq׬94qPEE# "x\ŊĢŖ [!bP!+C6ϝl(!j!^|E,vvz "<(lNt^ud9Vc:`N endstream endobj 439 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F24 440 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 442 0 obj << /Length 4835 /Filter /FlateDecode >> stream HW˖۸,9jjdr&l}E: 4 IIB$[?3-$Aɲ[Y(T{> `>,RӐeqq??خ7O݃׏w+Jѳc?ɮ[\{|Q6E "O?ݿeyf~OIi+,C]+ŇU~Pc9Jl*6~Ln'^~7HvjK3}:#p:#^B{+j|/,W?ڋKg/' 5>_Bˣ@0(1~Q 3^kq%q4TRQݤ9C yQ=R\#9g!`I<h$Ӄ<񊴠3/ tA)G])z߈ W$a ~#ayP$yyS$-NL.֏z8eݤ7#´~n#tj:+}@{NĖ#?::+ʏ9^qm\VGw)i90aFYWK:h pfz7oNK W\u swtÏml)\:&@TƼt"8#nJ=W1%M.xǪ冈 x3څAbQwe3V='j-G>RaN|h#Nn`Qsef*m!am[?פצlw /w_y'yoFSE@*= 3tKs=QM+!4N ඬR8;5A"`W\*f֌Z-2 -֖zc=Šwj #U`w{0G2Z{ I&5wLVFrNZ@'^FbkK)Pϐnyw~^wflVߢh{م2~ӗ p[e62t븡.AX)iq~WwrlҪ;q XA=73Iy .';)졵Y6 Pthw-p[ld\|{CE >IN WMz 8]؎CJ41s9{K 87?c+ [Y"˨UTe#wnq&]Xh ,q''կ8$NZLiTrUR&RxWE HpM+be|Gy E}۝/qv猬T1-e=RRbJʰ+ ,7g;kk_Ql؇ZSLq,4Ռ+l!sh66)F" @)d똾_gj"ĉ02];J;M[9#Aǚ1!o@.Bm94TMe8Q`ȢvXFFXS+^ qBWG'{4iGx6NEa x_v4$s@ibqM}<&ÿvAd^?~3lJgt8uh,gmcG"\r͆FdŲ>{nq?fju=v‹Vr G YP;8%KlGH6tެTHΝ>ܴl[yyxNW_FyLEs4q9/gٕ/V;81g ts wr<-jۋ =u SbAD{A-D>:p,f1$rѶz "8u,58꾈F?#~iC`8B:WtB{U,: EHDHv ,,wn{yyiSsy[s8"Zytِa 65]wt+ӤI^ G3mV'#V6N Lb)iT]821A6)pGaV56Gh Z.8XF󾨍}e>Lյ5xr4O?@C,Τ_~Z62/Cc047f1 % cfҲm#*]`r\̷zbNp\7EMh , .іe{Οyfd:-og/4 7)JZ>i_nz~'Ŝ[tKRwSӻv&wĮPVkӏtMVHnw4tF8lO I[iyTScӌ~/m7a$rhv7ȅHk1U'T0VB+TQ X:g`_Ev4[t4|,BuGR"F`8[nzd'e HQ5R"+#yc!ʴ.j\<ȓɕD2n,7͊Y_!<}OuYsTC2I,==YXď:lBQE3WE;ҧ9i}}R!nsWBe7~b"d* Q +z8zYa쇦$IN4>y.u#wOtͭvAW+'#f{z&VgJTٺB1U(rG~d"+!Q7#AEEN;@쩛 OA~!c+֌;@pc)(/%\0bz0mE%C3m6:P1t%=UU)TEt4I3*J"1lo-٬֎mg=YK'zdz b/h\"H:' |;ռ|_ɇ+ph>|sdÄg ΪѶ%%A_9d6WH8J\g1qa$ L+HPOq\ViIX}"(Fb =pn+l4H %ƀ:kQ|oi-Q"4R; lF y˭=sX=x5wt li2)kIrto Hڶi R+.\bkSxz|'6y͙kKwEOT L&Q[g~9kC!hn;b57`~DҊgCb7|sPƆ C-8ьE5-:@LReo7 Bz+fԤ >:,Pclq Z g;JK0 '\LMo )ï@36_a~1"-0~-܇_M8"|pTigCybDs`^e2& /lSAxؑ.æI-:rQ( #glLY𘥏S@GR' !r>f5IGaf)blH Hxyn qLg٩q"h td6[+ .,mՆ.{|^S'>Xp/? endstream endobj 443 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 445 0 obj << /Length 5015 /Filter /FlateDecode >> stream HWr8-M$7'v.u6ek'U;$$EZd4R e$en>}j1֓%sdYxA0qj7qw>ycOVd:luLfVȢ-zNG1'ӫDԌ{Ww+TԬ\]Ȳ9YS Fֲh㑶=$~-(!%cK#yQb08=neeۈ&3Q=X%%۾5]2^ ^[Q𞄹Z8IʮzAخAd/*!L^a+ߦثWg.؊u#AD1}|E86\Qlث>tzE#LbaIxض< d|fe GvĶ guT743y.cFP~ʂe*i6Tࢬ(Az ffoiFV'@YEN~WKZp7aawe%JuKxvMLk5V)-8S"yTN=^x6-lyD1!#`u!=t"gx2/a3 qUc7!4" t ײg{AjXI5Az&32P@uS OeEB[FPС@W3+ xM pDL^ByP8T/AꡊUp"o@cL4wBj. 8q(lO <߷ Rȶ(E|LO2Mۊ_\ j;X/z-]?}dR4hiU*{g28i o A Xqn`^ĺJ=Qf }:5 Kuq|5{0f{YlJe5`<ę+V5/(nfP@y*dK="( XkES. 5qvgk&\3IKs[Gc#QgAyIZ辤x,SB0(eGtHsNokjj^A=CzfV kd477Ujn:ѢT. ]lI\9 "UjJ]KoxaKȈOejPHȬM OVQK w5۲[݌iŴX#R'i*g3%-ɐ2: a(ۊ7ؗA,YLof uwXV{ Tdj1 zSbꍫc4eViM~ˇO 3 RlLn;Y̰4[SŸiexBÓ̞O_;#Qקj.[5rC1\F?y/bgHN;w7/% 'D++dƮ߄8m-ݝǩ\f{Nzxlp0_Yt FGP8:Nd Pw\!oh##:_hH? `~[|\  ;.&l/B0:bB;(QH}M#W,wh;_ 6 ŬY>of{bz ׷ai1jXu2G2zMz~BͶ Ihicؼ7Fel6NYC4 0?N(vO"ЛN EeޖyN9P}u4%pǐb7m/UzL&%:4Q9fq.-:cvd?FyƏtAQo*[~+QT\_&q0~z> &ڿ(t>G ď=Duj4K !'J_a^X0h@Μⵜ7ɬLnWi]:G骍cvQbEQke31LMyR`MRȰxYd?DCvC/!Nh$D2%!NhF2%!|CNrnBLje>o4̾\ܟ+=%(驁on>5vǵBY/q¸'"T}RtmFƘ|KI } BtHI}юTl_< 5t.NGmK1>o^ڶ=5*ؕ%mU8+-:U,:QNQO4<z0}lhpnjC};r G:iW"K0 .حQ`7-B`PỦvz8׮vv[>-"v%-V&O[.I35S=LY<آd=VEnZL4/z` så-v;"v;'!^#=8[@W2Sѷ1~/|U^{z08\9]geUڙ)&&!3ix)vp Ѣ|gD#$Fڡ2R!:bkycp}OՖbW54ιr6:' ܉rmW`,R}Ŗiy]a{ 됂X ̹k~0Tu9ud}mUp&(~vں/Kh6[whAѝZWh~+i!a/>Atd\tAG芵W<Z%֐d9ҳgZD}u&<b5;Ud.!0?}s<8V|TG++Dh+VWV~`2_5TNһasն|F7S͎A2Cl8PMQsxa%5+5(&}D}qU,0L nntH8H6< :ۺL1k=TcWT@C"!6m |EȁF1E{[ hQ]&"ԟ *D`oH߯GoN@Kc$Y}s}k\eQK2XC3CѱN-؝x{']ة/[W=-ef#/M-w\ i. <5+Hm}7m^N V?/whOĴ8'7M[EgE 󳨄=S+ٲJ7l_֟t' \h)@s-joU6B/6/9*& MXfWUXh |bwV);#}uSJnhbU6kSJ[g>P&-Ŀ1J#UVhQT]q,*Y'qJ!~- $j& 84&i.nݩ<2Ø\kajF w -XiP]lažLOx1gVGFY|˼qS=*08P'o$R//"x19Sвſ{4o{ޯЋ'`w95@4]5Q#ye>xf!m&ݙ!eoܞѩ^ !m*\gU0+S] w˯-[AmW{ZRg ز!D~c") v3v C/&Ե^$e_&-evm݆ D\ endstream endobj 446 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 448 0 obj << /Length 10140 /Filter /FlateDecode >> stream H̗Ɏ!r_^$$>H:C6MI|}YDؖoaMYDW( SIʡhS?Zgϭz^7/߫o޾yw껗_oOS/ٶȶjk@?^>BJGL\-WUgcQ‘ӳRfMM6>HFo޾zM}޾^UGmU]WKtFlTFW.h*S,\bYuo[Tx*&7&$UE5R2Fr'^\3a(6h;Xb:ۈW"=B:}}=T.˟{]::L%5 -US]n G:xz% 99\mRV6ᥜd]j"&ej&Q@ ΍`!?3fSvUP4\8TctPMsWtݓNg.)c0_;f02TG9 0g8ypPԥVmȭz[?JV3ޏn9!ѵ߽؋soYA';f;s, \f&0qGwW&R)q$ 4wńM$l0FpKGf"MՏZz;^HdFpK챃w[&~5du<P+D0ќ߉ni5+D(݉0 ~8655g`*>YX$%2;-=~ԣA r͡r3;@Z|ߣ9fxbF׀)m@Gl(k{G@Y1@N_cihõ EڂNTU&bLD*T.jwL13*T`6 ZNy.qt"k݉㬕26J#I^”g|̹0L^4|G4ex  hlJ\84169aC2΍\o|j3u]F4"-&pG ]:cڸ M?&tLHΙmf'tXLif[$$ 5Av#F,gaV 3.=ڇ,D0Hf'Y3_HW7"L(Ina!f.n*N[MD'7; -=]Q/DօdFpKC f"M gOƑ=@S'#QS]zeQ sU,%UAAqO4*M[4g-F/"4u"' i53)ZHdifAI^E~m@ѾNE( UrMb0Y뇦 5r43: Vb,lND"Jug." 'mQ"w>_XZ vby\2,8ZܧI8T/inЮWܢ] >vݽ{:`/$`=`M;n_;[ ޞM;~ݲ`1 W'wNȭn{0C`@Ep?M;ia-򲢦"Wr I G!]ڕ$Kj'n쾐4q5{Aŏ M;%p;ɺ d鿯'rw ^Q*MHPF=VFGAYQ?d FlZ1]9"!)HьMjl;pnX ֛V{꾛}q%4CW;$;^jjpfyLRoF=r\U8G}ʤ. Pid1 $ShҘ; 8p:Wdw,c@<1c)'&RsZO̊!4V M;ynO4&{_Z s劣 wԦyn@Xrnl&*wN{|y+pg\ul C*NFۣ&ժ)H[\7vd7m?rH Mq=S'nlivBO1-RL^ ׍-d7aL H_ln䷴޽a*Xl|7'7C ma`Koi<2ga 4)lB[K y D0Ǚ@w`4ơ@_^5G_DϷ<.Shs#xI>lo5*̼"=aJ9 }XK-:Q1"R+$:AFGo?(VRIp8 p}!iMkYyr]7vdFGG]O}^W9%@meMa|?݀nC9!D=KY=q܉؛<,{XmylQƨAUQ E{]s 8`Ǩv>&F{h hHjU妵^poV>Rxs>lY9:P724 $+|3C}n_g;yx9h"p 9%2lf_卻r^f/^@Z5gck(H4Sk yuv`ПA>v?_j*B5z0,D1JV #Ἶ KoNYYW/TG$ @SI MQPv{K;M^N&Fu{п/˥_ 슡#Nvvbn`tL"@O#ekW2U hł߈61=䥺0^hqrLΝD /$z~hީ^q538N3\k =BO`kXȘ +q1PC-MLnbB.$ %4JdT*Dpd _%5RJ2'N'3qhqoqI߯ P`^13%^f4م!.07E,PX#Ao}HwhG=غ,g'qXk2RI__Kӡ ⹈ԕ= $; !7dyJ~{ A3pӹG)* fҙHS+r@;nh5Ȥ !AJ&Ba )#p%O !=} }m/Yw7đI^w#lG{QQ<"<$kc8# )vo7ߔau$SCov8`fdi'ܲU(,E.韦`'1 ^[3C-f8øÕ{|F+].'<SӅs}UD&$K`fE*;C#rf-رjnJeM$㎙eo4K_bLE<[ag-H1L7MdDMDFgh1~"p[$j&' Jkn"H히)p bsjKKKbVj԰.6CԲQ EDq<#sƺ\\ׅH/2gLV-dh|!xėč ~x,1]2}=ީ*Ha/C+NvzȲv(rK 謥9">6BϧF$BQIS4rDPmMІLukTED.3`,]s <8YK\gq%>:;ȻA_k&>Lm#* cGho/|An3O\z}kG9hjiJ$I㋦68i~+dT6`)ӧz !!ISPVt2O/j6'㣘)9?>|`%PNZ&ǵSb7HXS¡xg.wٯi\!4 l T&x=(3᱙Q6S >NslCNC@u::ljS׭ع BO.䦰"\T4EJ]k MXire`ѻrKl(ơsEI8 &+ EN`̂ |W 3iR,0PZ+I-E.j0 `pC] l($vWݰ,̫Y%aZg 1$FB* },5msX6!:ʇok7Za&1³!1ؿum&.1†Єy^̀5…ޮ<}FRQb8t- 9ʎW*p>PPJESH FqĈAs"^{ gӓ:k:f֌c}0)pH y1_gP;Tri $s \wh/qڅC;i3$TEA@OQrfe? #at5ՠiM hTAЕ;&Mm9̞wbcH>7J#y[/<`ٕlؖޟJ,R6Żbb?\y/)ޕi"Ş"a]m9̞v,RWdW4z:?a.)\68¦FRY& Q>s@rVyl$I+Ul-|8zRp614~N2o΀_y*L>0g]WP0J%S)~8+v6l< .^>Vϕ\d>] % ڳњf76+/y<~- @%z|DT/SYf~6Έ/(9by( w>Wg\X9< ѷfjR0 q+3F> *,ӓi%h€F"E鷘m6 KH8&1)6jQZ` p(\hJ;>VpUQXoR2T%TN0œ-IU q Rp5C[Xl~)thGEyXڀz:@tl)&b/ YdI? j,sv<&~#*7xyÏ_?}翽>.?9I?}/_:jmZ<gA{q6ӏEPr[@ >_=$_׻'Kvlj]vـYo~)včؽ;Q 7D`i۵ބ81^~{ĭ`,xU[KF IP?fΧՋ%kӜ p;HRɸMO|50P~ѝи+gZtTy⯗*.i_ѿLA|/L$`/uS`W3 a#/~]-m۪ZfOwbxH##_u+u?&q 9i 5bcL4N֫OruwGg&6Wk/$TK97LXFRz]՝5z_nE۴jU6v,0D HSUN,ecl^Z`;&ҘgT3/VltM4Sj`&9cT#\ӛ3LJk<4N#- vFtSHj%V 1⪱Dsi=C&&BFxH AǑJx HC^(Kΐń(j:oJUHD w#N݄W;!‘YhO )+:7*!3xiV6NN |=]Lp R" cO,N<pVu?%R!)%ϓ1Ð^Xm!qR4cVNs?KR)@m"$h.K!4/!6+i#,M1Ф4dɲ6og',k}3 Y3|ɫ;5y:ח9Wh]YuWwmʩd1ƜȺC hWGʛs%$`A@Oukbغ EG`vǛ]尹&2lgeI4'Xa{dsFM:?e2Z%ˆhLeϝ96%WO#S48@ǙgcΕsƢ96OBməbk y$R3N!_d3J)C*eׂ~)!!bt$+vØ=$c(?cOn!Gv j!l2H˺l/X\ +m>/0LI/YD9:HX2n3L~82ځsK[ʽAP%Q2d`nͷAq Ri\pN֚m_5_ݖWmh>}**WDCUБL%E۷ծm9m-31[u^¯t\V.;}d{bnY/nzUpAq]߷꺪dEN$5Cw]}]_u)taw{lM]t.D^FZ[}U/}h7o}\mWժj:ˋ?oϞ b=k_c-{5(tz )#@? +G endstream endobj 449 0 obj << /ProcSet [/PDF /Text ] /Font << /F6 36 0 R /F10 72 0 R /F11 79 0 R /F12 273 0 R /F26 450 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 453 0 obj << /Length 968 /Filter /FlateDecode >> stream HUn6|2#J>cڠ.Z@$Q-.I9{e$נ0`Gb8ݙY-@!݌p@)}@ZvntqMaM&.q]׃y4N\ѵDQt1j3Z+`u7VW 6.DJYTPEŞPG!Oq{º*k1M:Z. h[^nK6]Wu% K=צ,1I:n;═Gg'a3-c(~|Ӥ[:>ק?;:!qi|Hܣ$qd:,>}^#n;犘&ʟ!wPha5ޠ!k͎h%S(0#0c;.9, e~EmeO^NOnf?Yވ2+PRE+g!Y5d9/BV8îU?tHէ֠W`LK&W([^ }>-=J/y]VǨt[OF;pϴ,02hPp35 R4.4IW4?cBݱT0bxQtL endstream endobj 454 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 456 0 obj << /Length 4943 /Filter /FlateDecode >> stream HWےyM-a/փJ,[R< ! 3)I*3 !Ub/O~y `_]ǿEAE8r?N7W~K|?\]dͷւ˲8ƭWtZ+9-N ~ZpUnPiEt;7*\`=rO@z0ɼLk>l-^R1}ԝjS#M4?+Rr%tsF4;kxP PDYu\')(5ƛEƞ4?Eyᚱ7 1ixm%NZClP`+El_-J۽Aק^;#_MEZLkp3bAQQVN{Enw}'mˋt;p%}] |KvL͋xiHd;~ʐ]ljƸ.558؊&q"T3۞ 9=`{>W3u""etL4b $_ hN+K =Bk OTDϚZmœ\Oء&aZ{hAIC4-@X@mrJ;ϧwFA}ߊ̐."Z)Zی !-r=PBƮa󺡾؊/h^Aħ11ӼE{ +OKb#-Zw4X5)1^8 XL伵h8$Zo۾T =c? [ X 䅕>d[\=n)!VU!i,>BT K ) Xϳp.?8^Dm=! w3 d9?` 1@|BS/0 8ԱV]2"љwNp)wDT S^(ݛֲ:JaCޢvI cAD,Xcv%݌"/2's6(:q)#4UEgh<9l}0rXg>|m``=+ݱ 94`Nfei4P ͑-QL`TzYlP<*ɓFE!K§mUe[k$ϕ_:uCxYpJaFψjTWeO/-I~FbhYxS`J6@"/ .z-2F-ISm ؽAjsd2.lM9 B`؋ݮ9'.oys5tΤ#4=ұvKѠ[DŠ =ٓ6h&^Չ$Td1c"Ψg$mU3-+fa:Lǯk0TݓH1~y,x+ET8Wh $̚ڱ!J{vb#aj˒/[7,17% `,øQ-~N6;H# @c`߰R8SsS 4h`qsn"V+jA4#[dM j x 'X pf3Ű/jmI_0Џ"L"E쓓MցgAfPRK",lҊs7)?mԹAca-Rܭ_XLrCѺHl\Mq;aHW ͝Fr2G\,"ܷ ó)ukxA=U+º?3b%kus&5Eg7Zo4I9jcӎ^s$Dq]ۋ-r /EUcJ4TVBCp1X^ixɘU\"]m@atBw{  smXk@@d9@'aNagSBx S m9ɣf5̏-ݶE r\^ z#M:ep6Asb]RG$ZM_^ƌҘ%FioME֖UoqG/&:ėI[6{4ǎf:}1*uZ$WsA^,ikGCXQŠ ]߆I,.wcS˥)7ʙ軯Bn~k,"L $+} |x!mߓw2gzL M\VgT/dKpꝩ*ʲ,Py+=v0'G!mg KZ\xhj)GXA3$60j"a7Fo6j;NKNLTztsJX* kbr6dNM"Ct WuߤfbA]k݅@4Ziㇱ#I75tswW-Ƙm?aZ\QK?+)˦`~44vG]-(Wg)+_#(I=yVсmm6'?S e!xh#g}V3z,:J-P9nۅYer[}^‚#QzcY.m#)VZ/ސ?\E*&@j]0kbĘ<.(X7Qs $Cbh\&l 0W=5)Tx^CnM[fjl[FtAML: 8e y&O/}^DèOO.~)y44̖sQD8gAS<6_QM |̽0'Nv}9%G=amhB3 +pk>Ii%IJSMJԁ [П{G{c3Gd]u?dgAHxٵGPٳ#dmkVdc{b'ّwfUNj(u6q7d4$`ήa@8 `hqH["ĹbV@etq*洰1c6$@PZb ڛr!tb"9 U5WjErY2zcgpQQmzF˜\09Ϙ.U)ʫXG%,zL'n X ߝgy `20Wxl]8$S1ӔC.y;<6jnLT:F2t^z4sE(MߊPpEX\.Uь+q@{bBARoBȩurjU^-GH:_C;guWe:}/I @>z=^:W9d0)ZTjfG#D  ëw   5dsZWA$T_} k[QSd{_ѭ5*tk>ڟ #og`.ɷ9{G sc[HLSq޻j; nu"И$A#\;vb_U 4-ޮrY* E WYt=j5JA?@ךM%l̈́nwlJ 9L"u=n%͇hOvU.TV:ȱǓOsCFN w)/h(I?;$icO.K9z?4@$-z l n<+ } KGxY/ v{_Ձ|yUmmrpti55~ZPC+` 9Ϯ6½T#j&Zd|EnC| MӍ~ABA^oU]FmsKo$T_` endstream endobj 457 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 459 0 obj << /Length 4456 /Filter /FlateDecode >> stream HWْ۸aG4)5§)o\Dޞ1Ytr:H̡=-zF*})(L& uJ-r6PAup R-vb4tݹ1|63ԓЧ,(uNYkMPSmEw}n67I'/%@DKnW, _E5U ;f~^=Ӯ`QY<ݢSnn=c{*?Ӹos6R]4npI$л58*E)w$PxєnE{3k6E(1 "{dT=jmseL{ĶqJy2:1z]Fy~Ңx5rҫ3D!s|IH,3uK7{& &l5rRI:䘛 'o`.0N+aK+ʭYg_OW5Y.Np3HntMGJEjm< !2۱jˁ/yJy8rb;dP b8Hp=c= G`6C^{gs WbR;0g}c c7M߂,5zǃ}}k,6adɥ7e+A;-V7 4|ƺO}%C vX@ݵ)i?uԒ7-Wp ژ?lΞxukU淈p0of߈zǍeB]ұRCtϟl.ONP#;.-@7UTͱGFT[񱁊f4tIf9TPk=6FQF+BhT%j"q0sӦ׏$ #*题Stj9rߟ쨬~];-Dl;xYIqIIsC,<laB\i:0 ~%F=e)A[-ظŵlAY? "ƍ 'lXd$!r"[T)&-k>MQ b@جz$;4hzIӨaqa$6UO(UѷbKFF|P4}Z2)OZB1WgO$d`Y r\Xݎ><̠K{ E2UegGG] /?_D=c`D%f_6?GDҭѥ+mԵJ xknRs˟6Ы2qUqS[W[?6.]w0%wښmZX%,9X!mUՅE!p.Т}JdoBG>-'Mv%-rM^2wт,Y>y/}@1_#}WSs*4PݽT/rK)_Y"t9[7@1K:Wذ{.B=}#xD`٦g ^HDBkLFa:5Ō򋪣!k$MMN%H.kVj*$w+5&t̙Y䄥_k/f!8K4mms"8\ѥ9cadIҼ $h.ňR'_0Q#0¨,{{@^mMTbNxd"~$Ǹ&4u:ꓒ+Ah! '?Lw29LMtxs/" =ad-!Քi$8'ymPbb#o9b-GHzzE% t1xT;o{TQYB[m]sk*Y9JPYP]FL $ qӹ85jg^bo|04e3( bL]Ǎ 4ոXr}`q[aOF&fˆh^)XhГƟLG@[>F 34QnI,.*T$CG*'{r'jX>v)FPg*=̱t9')٢`#QK^#&} L63j(?aYDǯx>;7T3S#ދO_XHO8 [R| ЇfE+ż)"Xƀt&z ;4a@x!k;l=ike0&AUJQ%,&b!B+js{IMNGha1YآZ:/F[*LZ},B&3wT/}q+6 jf(m endstream endobj 460 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 462 0 obj << /Length 3492 /Filter /FlateDecode >> stream HW]۶h~oM'>@$$"K,JeO@ݸ9̝;w.rwmo,ߖUlV[8)ko0e7/7w"$O7#Jakՙ$ຬUXܿ`/~Srwonn_mb"-xnVu'>˪p|+ y|ztK R~hTIL%*cNPM\̒$ZI+Y~6!4eQtt{rNtFtcY!bw~yJ{m,=Nh=tވ|hzv24d*4-had%:Ԟ}S 䡉Yayr?Ӓ8=S3f7+v5GeEŬzϻnYU>1IV+s/ZIc4fTDQfr9(( gZ0csq/WAv{dtR2,44Lk=֋ g1Ύ&P[&-pw :LaܐPPNW YrPTK+"I$v3 a (oi 1]@Px܋,~dvuGLZ}sBN 0%jtE2rO4O6t'#Q֝Z VG8HMIʀ;g2_/'W7 4R*"E' ]$93yze—NJ75p̟_?19*F胨tu~SJHHNz%Ԫ#!^k# p„YϱCvg" FW%MpռsB ?{ak-MDBkpKwy__ 'XgRZjHf"*bj(K$ZUNLswuf)a]O AqsKNQBQ():lxV.2a*?hi~howJCOa4p1IPCA* Q1m j?C#c5:3,<; ;B5ҥ)nJwq' OנL(CNfӔV*P ѝpv zN9"e?WyK!W7oa1@OFJ36AiMᒩsQwvy3@{*Qe[6pò2 bq9aR;=g qDPϭP9;ՄbP/»n\J\RJNYQG&UlRu{y+앹3!"28J5PH>4a׀:( ?\g>-&]?Ko}Z7{1A>G Zv^gn;?X*kԲDT>6U Fæ$qqN T;T^ ee~ygCu馑S0:2Uve3TӰxzU_DxśqB>OFΩh9^ z8 f,DC:~J \yI{ .y~48hAiҝ2;۸1]們S"h8`WsuY!tZR BL|6/->tctdO+  Vw, Ril`hhcBpjr-+!] =~w(OLIi]/"Pp܉p-/9Vn@]H`]ύ#g~htIa?Ж?8f.[<`}Y81O4z0$FTn@ю??V'°:[u©vWYIvH$An` ҢF;QM5eS<Ҕɦ^{1b)xyYg2:EN!/ b pā4۲]MqU2;{Yɦ2ÏdzG?fU7W/HID^NN+VʳOpL@|JnjX([jheEԩY< rt&GOBтVו¼p@Z]BdfN7Hw>0۴+YL=gԎ P(0pͅpw6Z {έtLؘoWn@C]`v Et$dT~ s& *m⹾s!ڋm!@o&"t#*jNryP U4ؼ.uED"lć9XBz׏&|`+mqC*Hs* kߵsw-[;_r⊼l!r/pl=3A;IB¶nU>M C2U{ :@KD*ݨH0 7ӭ0w `cP@#VJ⠪hЗI8` $V.|'w`lm|ו0nNiT\;> /ExtGState << /GS1 12 0 R >> >> endobj 465 0 obj << /Length 4644 /Filter /FlateDecode >> stream HWے۸=Tp,2fEYUVQV&;\w\mRÉ \iad"( [o):~N AÇͧS4=A{*q9vFKUU3P<*ǿIEe*F+wh=PzzuH4#P҆i"1WиOebjWdLՆSprOLO;(t7Wg gm}XЉ~ҢxQ4|NޛQX:xSܚg_cs!QqҜ)EHQTpѰf&՞ɪ^B)gL5#*2q?D֤:33ȽCݝЫNa톑zVG%7ĝ/!kH >kA|u:)YًƷl'kjf$j|sR8v`X.%VFNJs QՍ&4oT~_1|Dqf\QIհkL)B%5Q9-Au~>~1t,s LJS )Z^Hf'<%+Xe>`bR/aʑuסBԼ\pfʻşB>d?uv_r;JTSz!Z !_8.VXf㌷ <G CXCGϏ[vՖ#xOBgrK7ӎs{2hҊ|\Zi<*N37-p͸t\lh/ERjR~vDHƃ`N, ݄2٤g|_U;9°m,9BY /`m#Ǻ2|9tˤ0,/h.f 3^tinl1x=~]?b" ޏhY7A\ktF<9AY4)j%5 F5Ҁ9W0$[ꦞ8W@ȓk 7.6et_fejQ+հsҩZa8L]dS!4-ꢈaW "o~\ _絃)qTw7mYI.DLN ,u;n\+IP!4\1Dt%97Ns|f٪f$'lF?ד6i2Z6Cy}n4qc9Hzͥ?jA>k{<$]#7I&B9 Ҝ`"}iAD+@>S>TttLfƳqysV~2~qr{e&+n xɇԮ&֢?,>xh;a+^ˀ(s}Te pw^LKUWX)X0gג2Ika mMk\*hKxEQ3Brs_q*׏~h "L^@_Ʈ?s(SɎ,[|8˄]$ΰ`Q-30A{!I^Ѻy'MH3$tABܶ5r9v] ]`{n{zm]lYPv$Z ]Üe‹al3t1^h<1Tr" %I2)uMZMz:yz1WNi?eUt3SjVyszH cήzj[9`wC /ziHb3fgSEҌ~Nu}e! RC~RKMgLzf kwԘ39us/$Flv5uwA4+LBaA%zLsA Q܂/uR|o%)J@{RkIʈ便߁5v. ܚwQK2iPų"iᣅ&3+_ v3+8fH(T'" qG3 0H9{題0V٭X! W) qG#-$q&h=nGzvͣc9-P7 _ՍL:=MGep{LC߃ُ~=рyIW}zrbTvMJm"xU a =QҰJC?R zXe~ D~/COpnW#f-TZ^Wȓj4H;u^Z^;^mHN"ɼřW!1u7'}=^9'Î9gAl^ՙP?ղ۸ S/JSޛH /#r$8W{He''Ò؜鮮4e PŁzS^ O?Usok-lѧs/Lc:MAe{оxIW8RLc:w/V'ïCdXG=C9:I3l _s[yeGVxy'M'# ZbhNp x]$#Mq-H*TUΆ5gڕ{7cM ,yB Wߵ1-j-SOZ*1]7x՚'_[PiC6=Qx[eJc<8R2DwmYg/j vM4zFNklkKTU9q#::@pv{S]l9 g!S?׸;=+ԾBjg^ƾ;)aҼE.Ws^@O#PzWuDL|"f-cX3O^}KgΪx2| .V CRT [m1΄ XůvHFNK y[?K{F4; X2 z^o|nʚF\6Gwnck)Ϧ}(捌/#Q2%,8+e#b=bMMQT0#mMo90Z*2Iw×3rչg}pZ!|:9h;jpJG%Nqbkx4d}žؤl6)YslgY6M]*PFj;h'LUC{dbXpYLHmRŪ'~b9j  W+.&,.b*}cZ- ŅS%?nAaؘ 5?\fiF<_ݩ&~&+svB,Xg@2gd1POd/wiA28h+ޮp%vILw, HO5TNCh`cGvS{S#hP9ȹ+;Xa1`z°ݭK!s 9Ct_XQJ:^+nt0TJ73~2Hs#A v FHArZ漀b vU-jes7;e 3,!S*Vnܴ !U)3lJ1KO.7{]+S, 3) '_t[R:q>K6-6֏EVlGPǒ"28'۰l*?\ʺNZ do Oi_?̏_-i_ȷ'S҄ލ_.BIJ0 e5`ֵQdTuG@s&lƥ@V⽃@$uXb )h:!ՠ haPڜ\2? !dՊmoZWE,B@R6AN6n,~n(Tsq'%MD2/7Ȏ"p >jѩ9, 3XD AbѠi[õ,!{K^zUR(}JyْPB}^ "' taPH;8ML?Is:=B-/$*^tN;p~OKY߿W>g endstream endobj 466 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 468 0 obj << /Length 5333 /Filter /FlateDecode >> stream HWێ~ F4"8qIGdCPlٔVL Iif]`YSNnշI?,Ɵe22eۼ|!?&?#a욇Mq/_g7bdgߨ~NB(nW,?~`v!ωQs8+V)(.mN/˟s{.<B(o,eQ_{)md_lм1S{L44ROLssDaG(BN8uv|J9R!`k!W-kT"<oEQ9ԅ+5t[.Jq 8УQ 삼u6] KKQ:aYMVNl]OsDy7l1vqc1I k[Uw&〢M[MGOϞَb{x+sB ;Z0yxx4q6-nv ZPGB?U5G*%7 >#%;V>;WF{Vo:H"<,dR\EaVUF wj4hсւ$۷VHiSÚlEI,'n_ۚm(ѕ&iR8NweuFDEoLysLA BnEY\x.symEzW0Q06j,หW͇##> MO Ğ1C-"ǨwsvVsAL n-ND}6`a{NT;/{b0Me[Uj*``B#mP3n9y@5'xN|sY"c7((]$o.czn[䃏4/|Em|ׇBH!^,7``|oPl1 1,֠Xc(F!/RCt&q2VQťx׻yC u .)qQV띂LM:9vN]1J@LC.(`}ϰQ- ZZcYT,dӭV+aVAێJ8p&NbԴ\ xZܾ+Ha/Vz8ݢ_PYAz^U22,TB9g> ȼ/ƝmUI~מ$_ΪpQ=]aPt:_ilyyTmOFi`xWC>g_enNZeAl!f؋D+2z^o3j+P@jjE jh/=;~B__m:(HeFK7Uh!{Hj@W~Vݠ{(5Da?j|>!- ҁI-J,54JA!s?#FIL,n+/leb?$lU~M 7AmPp܆N+ϲ% W%h)l\B5 (I㰧aiV/tQѝ@V l`eŃA?Cؓe4Ϊ;~ӭ'N&xDNRu%CNjm#ƙ6S} ^N$GYҩ J4bSGRTPg,gcW(gW+9tp-9rWwymuoͻAޑEV]Q4 q-+4).֍;gYyV1ydL+ux|ODT=|yh4/K۲CuRZˌ6-iW7#Bz]vk m`ο&N<$.b[dN:\"L+E6._Fw}B ̀{*NP,['-܏n݇yY ]أ ]D:>Wmr-?U08kZzdXDi,I7jv=N pW0S%w aW#X f 6e5ax|l}|}ΠPA֕~#8ڡGnVуfVN*wgoŮ!|}+Y a]z{BjgOǀ'd^p%UKXlA1@Kc[Jɤ={, 4 1x8h#0Ÿ,y5f 8p^i5b[48eo^+/ps_G͚. Ϻ=_1 Rkc Lï3l7Î&菊":Um}vZ5^(U76~$f8}7W2Ndo۷ݚ>r4 qd;U_[%rkWEމ_]" ,/̓vbUX.EU>`,fqQͩCI4XE&% [:OYC B 3쳾4(y8IZ1 ,yk͂:C\Z,vnai-_Ӆ*Dogx>]yii=J$NTxa7ZGA ]Ԍbpd65Wy!k釦Ub0 !hy ZkXbFe IGs^뽓&\ cxnc%2"6|]e^Y/2uH?z&TűeOCKx,jkUG 2$04i+1K;ɐxSU,Eed ӄ2(u0Uhjoؠ]'(A% 4b c0čX }bm˙,c,@nr"4[Ӄ3k휕( = =2O|ͳMtZЅHkQrbyj4'Ԥ<(ͱѢPl!.YG1 +@(uogf[.*~5F[rțn7$ CX $€D{C@E42ys߿4K5;v@@j33)pSxhx!ƓY͎R#ViM#nU;%ܭ1tm:I H7=/mbj^gU} "W~3I޻J\?xňF߉p&|`A4ጇ$~"|6vo(fs_F` %JdԙqR>HhOi|s#SCzWg 貧f{Ի.=sćC) 6w !-mBǢIӁǷiII9Hw%U-t(;q^̬7T3{ :h}qyKm'H+<1# SOI]{yIY͋n'GF}[NR*T˞y\ZOK;* endstream endobj 469 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 471 0 obj << /Length 5144 /Filter /FlateDecode >> stream HWےܶ/qA! {ó-kD(D[R7تAIoe誐GT7'|)^ mMm[f'{*7P$sa-ԳS?:PuA|tk<}/}yalv6pV)3"Ig#'il^76* N(P-~'TJ{Gmk xhFS #?&A7x >[A9A 4h2^Q.꿯{`;AbV@9}Z?*8kǺ$&`? (/ Eʰ~^\u. "V"0smQQ_$lwbzUעnO,_UZcoLsXJ "(xx Esx}#&-W3^_J8%'Hh*})TK+t{A"9D4f U~&k|Fϡ(P4'#&O>)MfdrG[ae$#7xq칏bIxRo(}-Lm*{4oֈjOWq4 #/ҍ/-9:~̲scY~iק֘N=DY걵M5NqY#AT ~MEg{Β!%`  Gѐ0aVDޠr]{`9x$`-a'lAqKQ)Ȋug7j轮llW),FsNUb83Ad[F:dMjr+: %9j癗i/ف.tTEYQp'<N32r}6z .HKd$TM0봙 :^1-ϞIʻ-lꁼ4Iߗ|de. fT`X+߬#Yfex |j8urq[Yqxw;0V fV<R"[ji92>@;Ku6玢DopkқM4ਝu NlqV"&xy x1]\[$g}7!`,x ]g9T_,1!΃({`* ,!0ʐu O6?+myVυm~ōWp P=P=mO#; B~.q\h/שDȶҍ{kY?_hhR%iVz|X:l]- @$@ q2d1׭ Ny%:5w&hr}M0'iU?&_4R;Af<1~L1RZX-݈lhC}m!X!~ÏxрG. f Rdt*AteNv@ *ؑ)k-7|1wn{Sa-% )76`4yњd6p}ƽ;ikW)Z_j")+ nA'jVF?@.΍xw2Di,Bgʌю"MŰmn/|Kc@Mw2WCچUH^3 y) U^V0zlCE(̸TĪT";He;l6l*d$2MZ@u0i~mĊHfzR5.ym tJ6Ӿ0KM24Or7*%EzCjZ-";/Ejדe$DsJ3Z"lE7t~1*V+Y+Oލw=WG6^Q 9#9%.-YgLitc2H׊Z`P=c\-ψ7piY^ \߻p_f(y)>mڑ:tZ]BZ-t\ ݇f. 82Kƞym_ Dtșu\LџiqtEnu;Qqz -M y Qtc! bFU%ReCK7\x[oz9.6 bsh+;~e6jܽUɏ(bWs6ggZ>lXddNeeI5!sC+n6{Wy֡SQ=N#&ƺBkqԗ~έ%uۭ+oy9ZydXbm$:PƭDKqCBܭ)HܾXHm#0AJoX:# 8 ɚD6HHq+̣rP\Bl A. %*2 {Vq弍XT {wmbl`>h48l[+}? D8<֢g&sYhHNorA{;RpଙbYW~o ;֚¹6A 28@UF.A}Chq(fh{bŇϭV ˒79-ZwPq6eOƯ] p<  Yhh*KF.lFYRhxT'ȥ2s)L,GNpvo$^͸Ui yی2H} F"[[ D X*fQ]ݍ>n7rkhU]͟TE5.;8 J(\%Q+w}I<5~ eIUf=ͶryGmcD%pO邩81jYXDWV}jD%"zBaXI&eN~!O?}᷇߿%!*F"DPS<$ol^pVr2N"rYnty/e|_.H,^4Iv̤2HY!tjncBKʷؾ,ori|&# Fo)mf[vpQ‰} !͉JbD(g-XӅH6|zyZ$6^Ku2nj'ax sdՆz?HsƝԚ}v8#'Uc&Eغ|Z2 ~+o &$.lDb+Z9WaQ>ىP9OtͩHCGlsUAip2oeb/皼 jzͻb(Mb nrE~o7G\qrb{GbھF̘XWa7 fAgqz`x`I3I~EP\ jcQg^L?-O2Q_5ͬ2l3|b<)^A 0X endstream endobj 472 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 474 0 obj << /Length 5838 /Filter /FlateDecode >> stream HWےy\ &[)NeYC6CpH `i3$HEbIU[$sN~SHI2E.0-b:><es~A/3eMԝje6bۙ8U6;]Y!GP[7Eg;Øbӥ:3 D^XSiYC+o!fqCGt9Get)ϲ]^2Xؚ6GUcMp:}I5#EySbme*WTC/~jz`4 ǔ(va8_Q>npfFGtuIfA]u!r /2_Դ)ڶl$ߋIg!~:U.A A3 $-,dm J)0ZHj$erOps~ĞWWGUD jn* ʬ/K🯔` GE$QM/7\_ˆ~eIwXzI~[_I0Dr]+*ɦGAi#$Y[Avf㫀e4^[.+䔒CDr*%RP9/  gNP#٢V)z8ti,BS0!\|TOb> IZN>7z&׹mUu~\1TS֪'AHO6 Fŋ.NYB1u4!\'\ZI˄sbnf#Okh[xہ-p }pYcv avzV a&6S?u*885Su-msh1کU-ZߴU@.%fi=d Q$pS)w QUr@xjp0/yνi ? UsY|>4 /*"* ]Y[\Rbh妁bv_n O~uI T5;SITm<< bӼ,Y}C fKxy,&Q!1DK*!Jƍ;sy} ,*8sp8!+1*.{eeEHcIˌ'eG}Nɲm܎K. .AXETD7Lbg$BܥҾd |ѵOӻ}w8yo>erxEWĭx:|>oĎq9`&}\ϸ8>D_w/[.nl渫VnV^C&@Ƽ+Z<5VswSWyRY@ 6ôh'CwS\,bo/X}Үde=|"M)l%̶nidAA oNno>%w%E˄މXY-XҢ3ƎkS v,pI2soT#+]БTvF٫k_o"A,5;^ :QEjS}7^ '>q=ksY5 ʲ!my`0KVft|rAw 'h}z;:LXVBUNG>K1[U,*aٷ$V$I eixxݼb?()R(Mփf(9+fH i%rͅfW^ofՀNCޝPRu9q#o@>{:k&ܬhOSQ7B ›=бoכAw' y$1E?p<2H$3F<@ }%csӥSGy^M(qvFI(c_o0̟[_J`מ>/CB"i/iͭz%WMKSۚWF˯,t*48 9o{`~eaa0կsmw%_9]6ewpUwֽ9Bpֆ~Aǜr0APV8m"3 Q^F=Y~Azn0K6**_]m)B{2w+!F aYox`V,4hsb;-2|l@+5V;r,moyPEhŅuz*H%I2#g`'SU2Wœ*pSy//bSpJx/!YnSMQDN*E3H-s7Y~cBRәD/5*z}_XU: +_0nR8EǞ~Vk#3<_/Ujj /`Y䐦n\p&&C@al2S/ JQNB"r Jnpl^"//pUN+y3 楒Xc'l\? ^[H,-= t=WGNek]F5uDFzWXU 5} op~5FGT%\"03No<=c)DƯbD/C <7;i8OV۸\P>v̤i )ms0^@Q8WAfʓf ɣb' AxIQVTt;׊]pc*Zߘ7_ m@5Ԗp`!x+*8 j4~i9IpqHiYyQZ0|]%uw; kL&/Bn9ȓ ;D1<a)"\mJnzq[k],27*D q˚"@{\Yt ߗ5퐽 *Uo1\&]z[D*chy;b)C0PQ7U\(\A$p<x$EPm_=d;vo"-Q6Y 6 &Q7.B8|I? sH  \6L`dSXUpC_TpF„A<,`wm{N4d'FvCu~= :т=;K| Y2ifzB$ZxtM+DTÈ)(PrUc"i֋Ej$f9(6H8,#fa=72F o P5@~T{O{ RUcK3>9n (DM NI]؋=ZI", >f vޫ uSkV^K=8垍4йP]_%:In6V^BT&u9w_Hۺ51G'u9!3Q(7Z[fZ#O5٢/9vΥ[\zG9NPO܂LzgSfKgs 4J}@ߥga\YgdU/$mݭYZDId[3 ꦁB-O$A?-}4 "9`xI@OEX$g .0|f#y.L_+{Ni!4 ^.MN |,McGu5w +0ϓ{y~Z2#b+ʕu@R%K0/(U"huf11v9st /A.|@D)d])gN$n[oꤛ.h֓7cm:(ʼ{YO܇ePf E79ǖyesq>[d՟^_w0l[جa[ȇ}V,"Ru14JTbzxEW gk&hE++#^o`}MKYz-{6J,WIԮw_W!F\La'(t)54NL+}Q( P6lN^I*٦Wpvuh4nߏgCL]IDm Փ&D3vGD-&q7=6;.`'4 Q/gh-.;isxaiï,Tb8hdzT'l8J&QLO/ufoFgԸӋ ]MPfL ΙxZEY uaVjM*IjM\*J_lm7Dz gE>`~ [ > /ExtGState << /GS1 12 0 R >> >> endobj 477 0 obj << /Length 5597 /Filter /FlateDecode >> stream HWr}΃&H7Y"35yh-G@7 |fR^@w=s_o.^ EA||$.$"ŹaL6ͅo> ˛*eS^!/.$/6k5xYfxorc,9;5DޓU=^#ؒ}~Z 54#o*J!)zY^ߊ8͵/Dec+eWiE5;+tڊ6Ӽ3/]ܾ1ߙGߋ}\zID^;Yj?_Y M\Z˴,eiFR)b{rPa U\aHprI9RCkFʱ$pyIj"WmGh4l?ˌ^JE-iEn?E#i ZeLĤr/;cvt|bު88uP^:B2,1H}ċ08 $=U1]Ox]kxX}yV)l K70p~3`G6܈guMW]ǘ`=Xa;wc C/񁽳+b=$c/ fy0$N?z\3ӚQJ\5%w5-x"쏁-t@9ISR-VȞVjeR ru( eprɡQ&2JvMEL-TN6̍8dNg 6V)Ro"uX[ѱ7G!9¾BAQd_^!GvD&#z蘆&9^^Zf03˙K<>6uOC:ڰɜ:{gqԉm= f\53wb]  bX%(W r]r_%aKCeVlY=3{q/y^ !-X7OivO_y)F Ql޺xS~Lg=QVyjfa:n%Pklܾy~p͍Y:/yf'q{$-ۏT|yYQA/>`س&]V䀣r+V 03Nck{.c?}rQNe6겫#t~- V c{9ʭ/Mk)krռgn59@1쉨ֹF0֧n @z*ur=0]ŨY>8&M'7aP}7{f7Y3;mp'A&HE爡 Yww D_:hfXבnw ͮ G!J֮ OOdE ̪J?Rgk%K3'XFK$<}߈>!x~su LMq6 1ZĞ, }qT jm9_0Џ&xH!MvvzAE,[Ë5ONuuMbIduu]%-2PY(* ]!.ԫ|D\%vUKM]EMx]&J*$XE:S2;'߾CXH߿†"+vOw FkBh_ϲGa/^YL'7)9Nhpkٞx:Jm}N=lKXuzQ9-)XyV$EEF_~om%ܦrZ.6 Z& e#s!*! " +[yreEPՁ$& sY#USfĉzqT-Og MJs(Kr[Ȉs, Zkճ' z_J"4ׁܑ՜ɍYSds4bqФqذv@(K6ǰ0OJ5( 2~M%8$86;\lOe,X _](N,t2G0Kƍ g^^-*YѵvfZGǒ~7$z:)1x-Ѱ,۴<>m:+<?j -KމVՒ`6~@Y=Y5Ѓe#YTF:CU4+Uשnde5[K+VC>ʪz6 o~ &Qn>Wn O&5=L+E۾յMCœC QZT!#A@zhYUC{%fUai` SpOS2#K>kv\ o:{4n`B{N  Țl?+p^>aFoʯjMj_jO隅gj'{fikd3p+dI렁H|wWeBqOFhBK@wSd+Qx1`BsꛄMYe"}8i_SS㵣1VSN_/UP4}[ b*t >9*z#2PF0 ^!AeiTpBE(+ GFx &,imO OfiK,/*8BwogoޜMb2 prae>z0{o d唿w>ZM!hLCȏr24sMoLm n.i5C|nnAAތv0L=%+p,_>cA➱g޹Fe1ʝ#@ ,tKiN=,7I`:g5y GrB_xi/J2=vy36gYՐcShʭhY襡&mq֭S'xfw-|g[mTg#MPNgZ|M7Dk(JERE%C "DWZJ/JW`Q!^(jT;#]N]% bP N?[bȚe!nNJ^_^X,v ΊNYe|vl9'I2FcgWA[>P/{ί8M<6Ӎ2ΟynђmB&uIL&B9S(*nE$_$;urt&# }Yώ /C y?p8{aQ՘hG,04)0a3[|V(-LVlg SHcQH95=LY-Gݝ'n Sx"WO13Zu[pZy$ƖԀ5IL*Oi+ 6G5NIxPrPAuZR+76Wlb<:mUC\YYDJ7yx(jGFӭi}=|RomTbŝ]&U#1%>S籟1k4g$K~QP8(;wĻ4V@8pû8]uᾨݿ]a< DњFhu8i`(N‰u qYYtnZo$2!pg# ga'Pc0:nz$Lko>9- 4.fw,v; v^s_M4ls;>2k(>ҽe&t HgT) bVAC-۩PZ?-!**[%7N,0(Q/eԃ?\(f1XĴ?^c #+bwSR -:h֙rB k$`TcCD a[z Ɛ7׳0GMڔ74 ZפE2ӱ($#8P̠dqK`ŒDx<ai͟UI*GgdNR`ꚚA8t endstream endobj 478 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 480 0 obj << /Length 5851 /Filter /FlateDecode >> stream HWrJC?)[%YxJpIsAvIiI 'Ϭ-ɒSlEk|u5wgI\Mqc565븮'gCZefbRhv-jlnOT1߽}ƞgn=$ի,ICs0^9wk\ޞmvJFfi1񼸳 բ8NM0밳Z+ToLB;sS<<̜$e-5KY}YثYlv5eGlQ9AqkӆUN\r“ŢsFIlڪB˔$_VZU3IT32>(xERpxi0<],l龹Wt*}6cJSsXHFV*VզM75Sji1'|MHRlNiU r_ꇬDS3 %C F6c"o*v1h!JQ5x Z6{L5[4AC5^Y;muq2Um&N 0:A zHlZx^7P@s7Q7)bO0H~ZmJ#ڹ\tH[kUZ]`?eoq kpfTc Ќj% 5N*`ޣ#Ah2}-\G}BJ#w)& &(Rj 1D&Ԓr>&$"`xYwBXw]; n?>6?#P{n{{*WQYxR]On C~3&sOR4[+ÀQ0]u#qNxdbՒp֫LQZi(=mdDdcQפcL!yB.;~vg;qF-*UEhX:x~'IZ=^,8:ĿKl͈㺥4-Ea@NEta$6JWàz\q[!_xD_Ol_,뉥+]uxYֲ[D!Ղ6~ QzZㅩTMhv6^>;`B9i @ ZqS_ U̻ ]K^u'XO>b;4w-7,P`?8f!֤Gu^!-BzN'ǚ۷~$;[B^ޢnu׽_{b`8ݷV5J8t=>(L;xa9_Ǚqێe.xݔv|~T{\3vb* U#UlOVzX HіAȹ!a 0v‰'E{>Ok½ Pu7Q Ms?065\N:yb>}c1g$YW'IREP(!c剕Aqrsrz"XYeyUiMfal![ʒr.@KN~Tpg+1 5xlT[r#q3X6T^9էa;F8tPY$VNLO+=;-F@de!LM/X ~A9y+[alCّ0pCu-$2KCى5TY@U՞sPD /xPzʋ/P#.Wk<}2o]]M\߲?& Ŵln<\O]tXcb ] ]i!N?FPRP7瀔*I}DKP^QujJ.hl;i2ue&e"K~Y,1/k O Zmcq#5_6FPYE0%=N~$!g Ģ S3GM#nk~ۆg5:ThD#VAW!swlkWҵl(o o[\[}co9adHWKbOLftɘ⍋fHE獑0jzGAr g!5EZ2"GR`{zc c[VӶqUai2 O3+J?Hyi= Ԟ-2PܼcAt{uKһǰ8z&`B^DJ I/z^+S}? ȠH Ǻd"+P1z*(7v wp_;!nÊ\+ûu^=^rE_"yT¹:r9\B"R8%- e bÉ6`RS)^(x"\Q1AIͯ m(10)/nLq`j2ҽ-=-ECciFsBg"RO8oCd\DǾ8Cgk&N'>\YȆl>F]xsU]!j`+Aʜ+NӠD-y%c><(B!u}u#9$u"G Wr M/=9M>`vRiM Ԫ7RDT ϫm"~@T~iF!>A /TU1gxX~`+6K9$hKnj~a"dzNDjTިߘzp"_a5]窱 tE%,hme`L"R^#\FC05(0uSxDUd5Iolr]Ñ6KƵWS-scz/ioavLR>D 3fSOAcYBTtkYx>A#^,aKLudʊtU))q) ZS^0) יQ;lO46yoWNIZ8Ac>ns:i"Q;f;A}&f$yw=49iOư{C~l!@2\1Sv7c9e,eL15GYVh[sı9ȩ۳. R_']C6h8(`,0EC#g^;) X/<|Cf(jPl [9x+5/نc=NnEldjeȼxν|R$.!辢EF u=v p%3>wbZX&ܙQ7> nN7\>O?١Yݐ*5[ \"5gj ÆR0RiۭQ~D(Iv O"$W? r7^c0Z>`YXaw trlJ6ŗk2]ʬ)>%%[ѽ~Dy4P* w$CFݨIl46Eɕ4Ry9?^|trM ×^6Gg^e۠i UA*}$m{ ˆhApM[=SJ\7!Wth~CsK~k&s]w jW206$I}!Y Es?R~8jmKIݡhJqـrTj8˙kcشj8k+a)Dp[5k05Kq÷KZc,g͒~d-[¥ۈ sM|y\VĀ.-Au'd2ݘ-fiQ Ak0OSVs&W/lW b odfkD?XKo*F`BE?!ث!>  :57`(wc?wOc`\ `b endstream endobj 481 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 484 0 obj << /Length 3182 /Filter /FlateDecode >> stream HWksXOK'nMOCxC$J,KƤę \0AE3NO. (YN>^cRлlxLX01]bh QCSQ6vu)\%MohD4zFj{yݨql<;h4{XGA| /8I؅$Lk9t(`Qfάub8 mJ<_јP~}k. )!X*fe\$!JL79v:`B !KTR<0LL)Q Ĥk)tpR  /'"63L~ mv @ h|ϘЂL>E0 {{=*uC'&23nٶ[KoUa<| CK F+pz>D]ZNϕ@8&PhEo̓rgL}Z} 2W~Zr4bWApwZGȣ: UղZnj[ _bh'pQ㔏p\d i1mZGsX<.0qWރAWlaQ[᜽eސe' 4ݙ& 8mO`[1LZ۹bPGjhv;y0[L5p @! ~x"Jv&tyx͓]eTҞWӌuX0svŢD TA] p L%G6 r!hV}.<8LY)UAY(`'e$Ao}2ϕD5"A \$\3qQL4Βuvbrj"%`^]( ENg/D:>2"~ 8$v/fI8tX}vom}csk;׶%<\}Gͯ~s˯~?o=7`XOUy>㽍67g$y}_/{\^ㇰţk[[T.[ݓǏnĵ Jj+g?ڜ,癞(Rzƃ5U[ '˜*ӧ*60?o9* kFۦKQbZE&rTFL8' \(VBǼ*,S`.=Y$jMqұ4gS.|ɐ3)<_!>Ie jV2\IyT^> 5چk7VdpA,ʪaת?qhս8 B'Ai-K(<2ݏWu' ^_oNB5ezЍVlCy jUN'qD`t6;eSGU\JcDiNrtVN-DGYte.I|`!rÁ=_VL3VرݼE ϕ#w;2g$±>v{4& 4D.f;l<;~JOu4Qbc}2Qn`+c)#w67N$fwxO6{Ee =4nFn*cV¶TY8h>įD} {pfOPmYbc3kiH⥨WԽ|:lʋ{O+iSTlREu+RF[X9gEWZ戫|jM.Hn޷u-'xR k۴^|@58Рߠ@A|m]F ǰm&u%-B>:@bpJPaQS$H]!PvQ [i͢f}VʜCĵ + 5WvC,j@6N&@\suۨY @Q*5P|=\FtE9F!#`;,N.PLGnFwr1כ6lIG/Ed,B+Z%eU-s]㭄a7f^74TW it;jQe+AT!!ڡjXT]j I*=qI;) 9$<LKt|%; xU 8 ܶ|18u7* ʕRI9ߞWKgp_N%I?gmS#@75֘'\chnVEH+N K>Z*ĩcbOO-QN'KRa*f}e.h-kS5:FrpG*?䬲wוb֤D7 ᄖr@@ TUz3qf_;Ck2<6d>P!cþI~vJN9!B`3~㳁!U;Dצ tŨF>Hnt6P@x(6:uxblwh#CIHc0ǖC֐w]џ]Bwc]ꔜHm޽/bWz 9|t 6Xj|&G<_ k _U S,XEdZ_PeLȬldD;$t7\J%~{BSm&`> /ExtGState << /GS1 12 0 R >> >> endobj 489 0 obj << /Length 4816 /Filter /FlateDecode >> stream HWr<) o,;يĊ0$$ qI%0eS-ӧOy}@,WS(H8B^ljX|,_~]{{Gbgի^/p Ğ9[אָ~yZmSAiZ%zO/ML\^!Ǡs~MD/?>Ѷ""Yyq\  8m0﫳\v{qވ^RN?rF,uv.۲5l /0"ME^!m0@'7n!>FJ)P]T}TLG^T!EdQ%(Rܖ.3t]x/@]h:twwrV@!TY%e%aXplmWy(k4ڂ@^O 75}Djho򀒌?*ٕ/XPZ|n嚾oȪmߣS㬃ЋR{T6ZVhtj>Bn6%ZpTHլVԡ:q3?Ϸ8lB ŋUlQ#h~d~m/ʹAlb)IfIoViB4rf!h "[Q*𼪟J[a`dwۃsZI1!W[YA iCKqv5;&7f' W;ƹV; C#@@nh4R]UD5!9Q;uXPE'AB/X SV3ꎕD,xAX 'D])dJP"#}dʴ/w 4kd#~/n:Ė00R?lAU3=Y(s^eˊT=NԼ84UvIwՓ`u[jnZ '-wu-$ g5531YgF̤xݩYQ{ް̮;#(L (YI̛uL0. ``Y ¶B4@Zeq>,qXE6ͽ"L'2jX+6+։a7L*~X0 Bwr Cƕ}К> NK[ky4'ϰ0 e>$}M pgw u~4Gy`Ux퓼rh3/ -߇/)8mGbJ)@1 t1a%ɳjL ]B"9O?28"ti:dw5+q^Un- 9k$,0a^|CL.tgk *sgvHF9y(ЗWAQ_^/9%^SѸXd0h3C[F,:`=`'脆,%n_Xs,8vbm'>Ӫgyef*>27o#O"2y`Sg  g%ݼA"f0'oHY ɿy8';*UH ?;]h8%x/+_fnt5*ZrO ?-u-z~pgs0>,lȅHbB$ 6lgCoL(aEFۓtn ʵ0Ý܎=2⯀ Z4O2~L  / x~p-T74/}ETkvu.]`XA7qơ! q>G,l9 ԋ#g"b^+MпDRv08N];mSPE9sM^T϶yS+lp>?g@h,)c"ޤWky賱wfS&j4tG m}E iVze ˵:KWzgoR:GXj'|WYfvF$]^Ùݽ))oZmQ~` j!^\>ŏF"⟐$Dh,pOBslleH#@W@ְi^QNAE VF]ڽS&M>hc?+~ywD; $w-irTG/z;WײuX#E^}?`ID FpFO`I O?|_?АkW#]=rMfkq %F@3Q=ǡi²WV[tC:%lԵ~[SBM>&%1`z} S! ӾN.WOa}"||qEHich(ӜXrqn^ۥI^p-m{U6j^4Zwx@^]*bJ>rY;Ȃ\%~9XǓe>@>G3Ld*gjMOG9[29m;Gܐ0 rR(+,T u>;SD$7}\+Ac}km0FNzC݊l%Ǝ#p?mbG.['0JlՏ`CUGCi)W2{n\i! 3Xw_YG>sΕo`URo)Y} #m4mh(.Ǹ %6H-(Fbh˭F @s7˪s]ښl5E/L;[`}gzfpʘgeUt:>sg_f^G w05;ޥ.WMN(xd@^CPV)(78N )H6 ^RY,2.:կ_ 6^V$.piٚ8WkV^ (N=ӹ rB!ubkE z;F|A# 8rL賌K]&Hä3yL)d!'&9Ǧp,yvւtg py[bLTŽ٥pƯѠ.|-$+KYOs$بʥ=拓y dF+Cb,6m.XcD‘(30xW0ucbiFoo$Oz[\o endstream endobj 490 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 492 0 obj << /Length 1033 /Filter /FlateDecode >> stream HVr6{;qYV|R\ iGפMM1=|r|I)PWp8iBe$ Xfg&Ww '/' A 'l4OWo$Cy^n ZXF<[UldivY>Ķ3_[j>uW_l0j][~tGU?aQƇKugTQb}7R74¦Č4AѰ[#VFswPJ7R0"L 7]%/[8'sZpC E8ѰڡA63a}}#T;Imx9U)b<+$dI2d0X]X}yq_wr̂y/8DX'aP5YVYm5k#hcה4F&Sh endstream endobj 493 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 495 0 obj << /Length 4235 /Filter /FlateDecode >> stream HW|{)H|[q|+8?%:|P RmR gvA>ȮRVN|wvh(v("_yqr z_7@,ա")(L,U(H8ϦVUF??)UMo?pOhK,ҬU%=9:vH|M=UB;}PjwqT.%ph>ɓypFxkNsHiV]w`$QF"PNow?ݿo>y eI!"lD%}++]-~VΝorZꠚ~IکL i| /W zlxdt󠫧$U%[j C*i3[| ӣ3CtX̗1kA! wqTnY~QG#pMXq8(,KuEbcy{̓E\ {IY(;43 Z+;p3fSb(8`Ԙ`qZn"[qI7ӨFfvcġiN2]gxQ&ϐyʏ"ki(1݌y2*ct0/hS(U4C؞"LpZNFQ,z͙ތLQ$2XQ+ 6l TJ|/xU19P~I7ʺS2<U<(g1x% 6d4Pna4O`??@s4n5{&-4*!D:j .WOV4<  BI5Z xZc 4 #.3擠e)QY-]) , x%{%lE 2H#K5#!_?HD6'+pT)0dӰ4ڗ~㺒4ɧ%ʍ1qgVur!*\@(yx8ފ(-ao&!I@6{)51Bv=J٤^BG }3i/zhZ+JH턑>*'3M^71Mú#; "^&Vd-4>:%C:K}OmP zjJdɁz$]AR0R)]^Ca(Eӛh+r|dpKY՝65{d9Zk{,t{1V'#JMӖZ%AҊ<+%Sz-YO/Q1ao]ůdEI&v34 ~r.| ya_kC&a6\o6C6\g0z$~! T{_+p4Կ'a7K qN0DZP%m㸄/i6vLx&71Re+5Q ZI#^yfx$BlQYyDQlf~˗bwrPx'x_ b > AoqȗF.|>*RٳRAӎ⪜G厊}PxXeXF2E(# crPX;la,xf$ gSBLE6'a%ӵZē ?jZzwƩê?c=ώ*9!Fk^^7([i@6}&M+yP)/1l\dgk_=%h.>HD tp `s1\O"/>nUiI~~XTp>z6bHdw po]]PSFWNqqmJ,/[䕱`6)m@5s[:K%*I٢TTEtl2B$~+Ih"IMQ?|I?R";c٥I.a9?1131 ~0 i"@WGo2Ch=:V8aapo]D@3Z.Rww`@NgqĆ׼ۖRX}ֻFPh{Ou~]uu`pʺ#ݡ'fU'ű`X EFfuAeŵTVXByjQJ; P*o)n2V#+*CN=2rA囿{JEۜ'UhiUcGRI> hlef)p S٠KT{p;iA/J5%-3[:JhVL>ҷ=ۏ|?(vN'Α 40/38jRڰ5$0;2a&L>M9 ut]ټyf@=aT(?CHӣA%3?^gM d݄ۚw6ݡgvԺ0?R0t(%rC8C堝,['Jg"8g->_mq ǺfٟܟFϺt{,s(GV'j$t5D w(lYw,ΒxZ/u v _W$:^{Jq#|*.KMraxw#ɀ>5>Ç܀-P(e)[g1ϏH}!LWw;N/".P2EDq!v@P5':.3^}X`٬oFt$ ;pҗQ@Ұj2ZV6SLLZ񯦄~:' ab3}NTZhBHn ̩|r1=ɰ1ғu2%i^OQ)4j  \X >~||˛> /ExtGState << /GS1 12 0 R >> >> endobj 498 0 obj << /Length 1567 /Filter /FlateDecode >> stream HWr6o-$N^S%g%RxD{Ξq]zvd=qAo-+$I'ǡ(6Cѫ !)adz_/XzѥX\O8BB. QÑ e#&q)KPoTyza#PH<$-Q=l@ $-^ `Ċ =t ]atz>OIϯ,S:5ƪtҖަ {g&Nې S.ڮM^S:؅SkԝPQO_^6er=/+ Pj\Nm\nWAҮ~:K('Tw6JT3t#\ט{Wdb#啊+#+jDGyPG$Wy*o߱IА&y-b'OWj~$qhS=Ʃ6W?5zóBMYj,N:&>(d넋I.F10:Y*U }(2>]8Ɉ!&%dYYݏ1P c)퐇atU74p \GG+y%˹hl &y-w \j ^Ugm}O,;P zQqI޿PQg+$brvxge*{U(so!atBlgg0v ˇ ͪJI JKۓYfW]*ʶ辩KiZ ܉T$L{r`i5@wkU"-}|}[}"뭑R*bC~fJİt졳T(;YiӝB@F)ec˘nYl Vn v{s^u# I\k1mR $XvXANwWvo Yu1l=0oڇt+0<훝4#/-ta3Zȃ(=] 09XbJj:X5xeźYnaVRf蚥5 t}[ ;N׫sN׼.#a*D-FVThe9Ǘt?W F!alVM?2(2m%(p#Ey*+Ǵ01=ɮ/[oڏ5i}%Av)|hI9{}5`G=?I}xoMZ,j}=͒zW]ChR-3^GmxEЬTtǗ|dk>X-8%9P_ӧ*=Xy;C DŽ<C=R7kL4ꪕɫdb' endstream endobj 499 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 501 0 obj << /Length 2504 /Filter /FlateDecode >> stream HWے6<$wyq=coʣ+CB"lPx^gOHJ3ɦ쪙!FwW߼<*e.,"' =aՕ<꛷۶Wnևkύ^?9טBַ'Z3~yɚVuWaD+xd(r8Zkt:ѧJ``dX6$J| B'vC6Lz+ S?ij;~fV=f7rhw~~A*\%0hE͇xI:^dg-_2U#{ $m6"ng>݉F [8lR'\뮜 uǸLU窒׹(즑wX˽hZPi^GtmqZ|NZp`n1> MGq/0ce;诌Q$(?p+j2+LdX8UX`7P9q=7%llV2[&F1fSWgsb0Ńh\)Ql֠g NuR"JJީF@A})/[;CED:ntJ|qh,~w-s̯+z~y9' %h:Lb?=-&dIIX#Z҃IUx7kjE vA{~ v(9`8'B -Y(e]z,Mȓ&8̗RLy"UQunqYף&t)Vȃ>lUMh":(vh-Nrn;DC?wPi8$[EMz҃T0n-v+n/TJ=P޺,`i&HIo-e tBc|u&v"ӣ, 8/D+,d#;Q'GNTD xG~8g*YFGg5 ' t4ʴvdNM!#rr 7դIQ cD_ <}qU2kVS׷LrN"` &N P‹<{ը e8'#kP=݉wR/Θȃ56خ3HrP.."o2h̓Q9#AӒfv!~5 m-NdbШ뱖su{SL2|}gz̾M}0ۓ};10s۞֟]UVw&*,Qq~O֛ҤDI)ܖT L1aT&xajh߲킄Nڀs &~ v6 }7 93bƦӉPsF(TEN a? WЖ Zf@]atѦdB$@(6\BtQ8b~vSZ\w؛!O 8$6ȨDP5DНK$+LGq7'k4jj%)c'?Uh=7@AG{^[17/Yjݒ~3FdbpjuyiR?=Cu=er7J.y&7Ga}]̄ss$vg+7^\hsSp }B>˕UDH , HUgBrTQE%'F7NEqDUO@Ԩ/lS_j;^4WZ$Pr['gYgClxu9/)_FTQwU Yn"TFrpq2@?\Þ{٨Z_g6v7YV!}lpI1'9ܮ+3<{Lkl~Pz.bA4*lB1-> /ExtGState << /GS1 12 0 R >> >> endobj 504 0 obj << /Length 4989 /Filter /FlateDecode >> stream HWےyHV).%˖-'J\Z&)W6/0W!T'g]i҃$}3߬z,`U|+XGC/ㄭW-`W_}=#.:W_(oq3Սy'6)faoThoJ4M2vx&j"{vM7daxq, s/*C1n܋ͣ럾{ٳiIͣRz!y͞"/I"tp\0Qf{^v}aaXt=u^tQ /ؘٸ-},K~xS!K^>`Z*o:ZV"QP&'ZuPm'U<>:1!_0q܄^lz 6ڑRGQѝbvHclmd:܈  n=b{j@!>Ǒ' Z+My*`ȍ}_wP B22'"lNA6/"4w01t AS-7hd+ |Te cKJj(ki'n)PTDuϿ=*z6rizu)J,/UFiTGUe+((|Qb&yW6Ik]d+v˻wm|ݫ!ZWz0(dhNHxFPީxhx*P%71\ҋiriо%*[DV!%DaӾWYt+zܗzS$x۪Gj8ʊf҉2j%&Q엾UeY'Abt9 ("k=5xo{Y ޠ^DaWdR@PDS,ޝ #9*~7xm'(b%2|; ŖHw'_@4DR=CbY@qy:o4îP=r;z1 chPS p<h*0=ߗ#2R"W\8-Ei2HMzi3͑,^\l GaņAb{0˵@+STR Y8-7tBhYsJZ4>1DK;;RcebC[vr/Otًy75 J`G8Q.K12ŝ"U8I/&ːz0-mE/cմ~(#J..CYdI]' 뒉 -xT^4ܪ,p7)diN}}S>rѴ4E4(jT :O%X,ds.^6)ghO&ns$ OHr-7Bel;0Mj0^{}& c֠tS!Ve%6ڟjHGpX̃wVJlL{{Wَ5ߚ֌3hp]1'.woX 3~8 緰.xv yGnFZ@\i~FzU+MKe%JI>H,̝I[͂V=&i헂݋-Y4E[^<Қި7^8n_@}Vj}<N[=ϋi[؁CV03aq*@v=HۮR CNхe UGX_ǻ,[pI|NiE4CH=L+diZFvuGmڞU; n\n1k)z'Nov~Ⱦ4S%ꣂ\%8-:mVh$o gJR̩SAs_С&Ql4fs/;Q}CwX4m_ :~쮕ACB~.:n;viN݅5Kac*֊D}0SFXOѠ,QpT06?2SxrtwM ;!}' }{v9ixᘍqK0EIG^.1)=* Zߢo h+zwX)hüYPO^}Z-*Ȳ 2QDKQ4&{$[͓M/Q)Z20̿U XiۉUn\ASa#7"~8X2& m$a ^v 0}߱}qII'YiӨ>I%IiH{Aݴ>o84;ZjXvt嶕G98rzu3y?Έ ^r 9 -cf R ]-VOY}hͦ?ղqE JAіH%( !Qa<e*?s6nM=GI|y;(r*A͢goF+Q*ͱUWҵi+j]h3svz'!ۉ!A[*ӃB %t.fr@~5=a䖋~TξaMQ7qm88Ih jD$cV8VǺ>]* _b'߅n|']gقyDzΦ> 8wfh{uay z(&/+&Pk)֎pՀESWݙnjBk-L)&yΏSV~goP&w[YOYHGN 5)Аm I6!6 rW,d^ijZR۩<*lk8^>@Sqt7bHBWԌU,ERvG3+ODiahaMJi!{; hi3.2kXmg\0{:Aa;JGG7^AKr #.cv0%l,ȺSwV6҉jbUn?$nަeaެ+P؂j%76\n}| orgi$xgN#shT?BAW:Ht)t a揊bk4:TT\}5a|gTa$q )4VެE'uY`óAīWCB#"v"Ȑ9,x[L.MX)$\^cŻ 1U7h.sŶ @DkUѰc󈮊1i%HnE0zm$W:d,a]wBcx?n*Փ$(0N I!/L`M3 u m}Ǖ2iԡ 4 Gs(7Y-3Pzʫ^,~=A{?Bm6+jHf{!>(Y1{nq!Y){V6=,?9D[,+?,ӌI?j\a_m8aNH ۪q*o܌j8n6 v8.QҗԾV(¥)Gf{`F% M=UDPsA,Hs7HO}Hù-Mr۹} VƏMH(fZ I2~kM7+(I#sԪHp䒶 j£R8"rz%Q*wvLJDfLO?E 6yTTAQW|-XKb!9}~֢#16֦\!"zq [l;R Tдt OyŬ]M[)GZq*kK~xDu!&p;,$m-u!T割a endstream endobj 505 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 507 0 obj << /Length 4689 /Filter /FlateDecode >> stream HWn}h~3H64,9fMʐ|? &87wB?Ɏ+QHeGbu {US1hYE{j4y0xi6>$#[v6GKs ׁ -ٮV֭aUWMϾT{Gtrtq'r~-dM\/x9ZMA3c[zJʉf#ۮ5r*ۓ# "I)" .;<ȊAB6]#e&Rs7cF{8O/z-D&7ݱAW]OӚĩ)bxۚ59l sJ8V6G+0>lKgQX+*^K@µM, عO MA'&Hc8xAD]xUV3I;4V9YCGy]ӹɱyNv'ϭ de Io}JUEQ u~~kiVjc3-<U)|vf?F,lKeRѬ7=;( 2SAkd(?_$ȠM }<.[ț0K/1& 6&uE2;us;p<  ylQ EiY9n`)p@̋h<ҧyk`-26 8+bK沁|4_lX: l1c V-Ir1ݵ&IV^^69R{A,~/r[H5å8|pON̷)+6G{ Qfʲq6XLƞմs%|fHz@'`78Ӑ 8.͒Bn`Ic  ά1wΠ t*&SgL~YY`t5;UNYV *ݙe#7 5ӻߊ5ak%pMB=4/oi/e#7dsg5[Ĺd  al{0^9cN{~D5HR :]Qd{TW*vRS R,5ص baH7hY=@][P'~2JзM#Lvā mL# @I2Qz=ta6YTJa\+YT5 9 ޏ&LSkd(TVh}iᱟffIQfE1^k+=6|2(TlS skcdwˀJ ٹz|FsjMR[zx p>ۍ+%i5iq.B->D{lL ЮVQ_Q$IڷzmƋp  C7+59LA b r8#AqTCLsAYԘxpK2-A7&Äy yT[e'eB}OI$,{9])s8<*q\<042IN ` ^sǓϫɦù4ꮮzсUWvG*;o{ǥ#8JG8qZnvu.g^kF[-%Ex0U+Ⱥ0Zƫ(^xzMitϚv`=5 fɈm]g`jd?wHAO [';^>"qτD|~nZcucG?LzB',/C13~\8Kv^ h[Qцm+jۻBGC mT.w'YG6j#Kv9eX<gZ!}aS̅QfxKbtH4! /r!5nߞyݙB FԲ3AJVy#,yҫzxO Ű~k*U$Y`q%q'z&Â@<^^3a]q?\ؐRÎxv1t:+}Z\EA ;  @S1)2qEĺTֽ)2=3ezřqqE vʤ-,c$>|\8z?* >#HE[!&BK ofl>z/UۄQE?˵:9 tzd\#`\G LE/2I$4gCPv&؜%дm܇w<߁k hhKizP up݂t$! :h!y*_cOxp8/ JRɔĚt1oIxmPvjL糘",ȅZ4rt04Ii7nm_zQt%)XSzXI^o37'X'ʓnƜDw7K{2Ư){}n`JHz ӂT3%E>k,H.0[9Y0OW@tqPC% u/TXTmصQ-Vn3Xz`yRtR;o;nH l X@ _嘤m60)YǪ' UI^mHߢŊ3+B\ϔ$Ω;<<v V.r;kNGly`6ojne|I ة˽h#R2R Zن#M Jz\70%ʙRk:eo`&`{!ӺƒM6 =qƑ3 ˖ܮ0! '1ɰ0Q~N]؉g- ]`) >9mԣӝ8*V+~D 8HRpLrt*(5 @>Dn](^"ևi DK;~bmcC%1<jNI|55D>rWy\%Zx _` w^i d im:j[Vq' ܒBYb?h~=Ʉ Uzc;=&Qu(mڟ[^-ZAͻ310EL')'G- ~:nnA %i/)M߀mD1ʈِ[Ι>ă_&_9nZlf_' endstream endobj 508 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 510 0 obj << /Length 4178 /Filter /FlateDecode >> stream HWr=)fSR<$$aM Z|f.H_dlt>}(b[on*bidQ"-$S߄=9b[oMa7QX{f E ]8"Njon;Bm=~>q#{5uoޅAR*K cO9ALbȗػ=3ԏg#/oFFl l+޲ee}~#QeG[', r_KWUAt`TeٔCP︒;5w+Q_{'4'IYlAIt S tkx9pT}(MBɚwLu=WF=1q ;?eDm^=Q _iZ|8v˾aGٶLf[[ ȎӛR6)m26b"*R5q¨$ "?CWG(i34'pЖzGpW^uywFK*bZZJ||ؾB':*P##'>CHub !1L ) 8g/ ⪚GG)lPHRoPt=jEg)ղɒ" 8uo1K9?r?_>*gRIO(.K`~j%ӊ@ :J(f@/Yk&\.E酂bǟ$Բ  A  jP{5^/}ss>@}6XbbƏ$l뛀}߳/ s8r-j$CQ#dg?lV~#k|S1F:$e~z=؎7Ls٬Q~˸*I$KjAnRyN YN3$(⬺$^Y^;AQT *!mC3Cbgpu;ܹT$Xf'v;5"*Ѵ\l:EmӔe\rQV%㔌b52 ZUc97xkQ]v٭k;Jn}&a+gXm׎uRE$(WLiFw| pAsQ:C_hUE2iAf-̊MbqDn {^6h"ʢWCM!f6,ACF DZq(WE^q?bCn5m Z{Q FnPzU%w3'xǠu}Ba= P9aYyg6Q9C$XC˵A^C  `dq o.L]D؊y{X5dڜmh#d3wK1gc;W`E__!g[Uo=p-ݬrǮ?oSp<6lE݄vfYqU+ Y;6Ͽ˦'zسƣ c( !7(\ Es^L[$ށoޒnʓL'׭`Y&"⤝m/]-u <#os|(9WM0/3J\hg7 NjQ% F(tUfa_^)++_nX7Z# vKAA*-'\2+,uYyNh ..xkp );Ȓ\4c];t+q5Y˕k)hXXfFiM H\=ހƣmmgf39|w'v 8XLW\~xfXmqtv׀V,&Yȥf/:&| ]0H#cATy{9t_p(Zvn*qӉ < @t$m9!О?NdpIah6Ь=58CoCB|i$Te f]; qI+!xˆ4Қ@tW '$L17 H0;B vb9oz(~S{Vx TGwr1-6Ny86h]hrЭaE*ӂh<;SOs[Yi sǭp=zyâď",Gq`syKLkR[\YM/ZI0P+\WnE>3+-4ǝ3@w =v0u*'aTbAޮM@-wY]YlF ׸E8v`Bv6pnR䅦hkk}W'0l89s.zNjԪ @Wzitd3@ ͮ,Q;, dwyl6s#$6ӈ0'7q=e]߇LSπm[ lfs*X4Wa\S(vEw-.(ZBˬ(Gy]0YkG[6wX0ݓA'AM}fq(NKQIN&.)5hzgtdS3DBJ*7Ů@`OT'>"ʧbcjW߷=̅7XNr>NG0=s`%9)ke/ dϽ &oPl'5n͡ރoԨ  sWq4f@x{dbEֱ% y&guJժ򲀯mW( @cA#ȉp~5UpWi^O?*0cƁK,qڄVH9nj^| +F95 MUVicYڧ~73מ.q蝵,s@ClFpg%Q)U WlC<_v:/Q dt/t9)wRcQuq[I1jZ+Hi={}=llΖz\z S!二 !=$(Rbn+9g/^>A8UY{a뿷6BXa聂#2 <ǻ^rv L"d l"^Y'F#v%lm1JM~Կe <϶HUɼ zMϐh@[^[q`r͞ye=UW #:n($KSKZ%`(hBD®SUX+ 6<׳7M{jmfIEk5*Փ֞(Y!v(zFJCt׍4~{? 3 endstream endobj 511 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 513 0 obj << /Length 3757 /Filter /FlateDecode >> stream HWY|HZڎ o̗xz3猳)g1YgQeI[Oקo{lo(㔭6mu~zW p<$[#ijdmOHT>ʴ/HQoh(ƠK{OoStQLl,4S[ . RRm؇V~52gfwh${[E C+Zi+6m-)'3#l>Yۘ%yc6_rk&~zG(Oq nďN?ATЩ)sN4[gw_VGwV;y9gY%'[j?]v$4LXZ+h tv卌QoZxOO ~Þ([6 V˹+vud0BA~}v.cktFJ=}8gY ز5 ( {>ُPxMp':RqEH65U2+˵I3ђYjÙ^l}Gxg5 kΒvq-p'|Ldz]ct,mȃd[ϴ?SB ;f2EQKqk?JV. a}X@l횭fhQըL?h"0E.:s-/3kj=_-jΤ/¼:_zuɤ"94N쪙v`Q,A+ljzpCcR2c9:L;'_tSm|k8Q QwjCࢃuӔ2o`9ϵ<=8(aFqj޽Lb.j!"ERg#炪 cxTyOHaށok u^ lQn.RTOrdn]C% M3bM?|oS&v`0Bipj]Fb6h܌R&p~%Γ'~QT[U&~'#ֈ8 Uu"} s 2{@nC*pGSLcT[)br1u,|\oľ>txа.il\z?n_Hpp nP[^ɮw۬'ƘWc"TDw2 xY0F`3o>u\Gn/7Kɒ860c:n+[ vv߲٬=RA}R- 4`tyN%2w:*i_?J%ͮ׎} T*e X1rbZ~UovIڪ7oT9(rH~nd۪q0*tUP xIhWs*7"= Ԅo:bxg9-}"OxI5ر)}n`,r E~ Ghnez7d0Cl\mתCK< isaخS/ Plb2^_)^J9x6d(7z0RFi'/uBPpTG| F+ By>S-kVG$ fM7#zCߺpꊉi,p3&/])7-;~GJ:($; p?@y~Q1n۳y-y޻>9n桇>>sd6H&""FO8Lem z}tJl nz\,Wqky:y4 @pPR%8A OpU5;fzU3;4"L6Y#`Q@hM==& h!<(XR5֓ޘ}9-O~* endstream endobj 514 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 517 0 obj << /Length 1743 /Filter /FlateDecode >> stream HW]S:~ښlَ%C r_xcQ2gmY`3^njlnӧu u{ &v&)}[nDݑ~ByA Q^2lְ6(c+z)AU#Xhmٴnk 8ģãGLUGg*6N֝ȃ <)( L"?O>V:S_m3nBd0]RLyo"w%s{- .D3F̃(M(;oh3Ŕ\[WRwq ]% tȼJp) ^[xMY^q` Gj}q9Ľ":M1)@=vWM!}#>LBz Iӂ$/V-vki] 4a~v>i8rNݾ$AWF p3 s huךpK4aRbOFu/u'mUއZSנ##W\&ɨdk,G`jk endstream endobj 518 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 520 0 obj << /Length 3853 /Filter /FlateDecode >> stream HWY=ACR %W6g[c;$LU]}#_Ǿ_"E%!ח/_|>D&6Ho-f"ϳ\dbSߤL|O84It&6%y S٪&OL͋6*N,I31͓EQ}@9w޾{+^|{M:IX.rX'l66q9Xj4{ҋΉMH7G4%FuV(GՐGUQݠi镰Yr[U+2SvHkZ.p;qI4"[GkZVBקJr:Xq*!즀OrV,+)>4zCgm*Iُ̮ל;<$z[$ޠ%nc"*wҞkaͶuQ.P-zV UE1r4CD5P7tiMi,Sl ~_]h41'Jj1"vM,|/>Y= 있;Yb@%0bCQ)b$:9e*+`* % S}Ç!!޶e v$dߪLįQ(Yd@9^&.P.77xh9RªJGhX9 \%N2q{65JKk"TJ8F8%`<[h]śV' 쳚5y?r<= [ԁؐy;Yk+i'2(+Ifq[+"9L?:92t%ufscޙն ˤVar8!t} l(6N?}hb6%ox[dLM!zXo'*)JP K8/|>3jPylUױ#'K ×sL>"dw'<^E1nlS -Gn`lQꏖ=w4 <#n V>Bkwd@O Ø?H:2gsbޓ*ؒFtYZYMj^!fR$(Ķu {F 2,ִc5}â j:!dn51A> k%C(b^Ƙ0hvT_B\9[=#3e"; 孿˶/>[?DcL8y^1Uoq^ \Fw H?&(a7`(莔:J*շAC7h4E P2OVYed*TvJ.쮒02 f1CP8lKv(dx?@%~}Kmw3FyP=&>LPT4su[K }|X餗;IJTH2G1'V#m/0G'w5)z MFc$Lot# Ւ[ .An6LڋR]6WGylN>2%RK2SI[M &,Nl\G&\6[G>+;%MJv0,.%JYUg3-HBƦ<+=";Oqβjא4[N2(3 3g;--Q$tejBKR8(:]T )ؐ 1}:U `5Ub\ѝ6t ϲ@t|2XYb-I Cj- N^}0ţuu|°u(yϓG38k*b2@fDSZc*s>~%5/u/?:?j w_P J).S SoEGWE d>lխL*O\ 1p&=p`! ކ<}ǺmU;.Jv\5شch|/J,M6 Py q>e{Rۆ;6 [I#g:B%#,I?t0чiKkY{_7Lvg`.B05|p0 ! d$30V^`RP`{!VؘlMⷓ{rm+ Xp7~鮆kMϽK-QW ٚ-MDrqsB6[ҍwjSP :CKܬ=ʪ7 ">+V+)zoTNөݬiJBN $U -a6汜_ߓK4Dhd fMZ1m_*Cx2QL1 ;`)&nm3%M#{TXUBe?Թp|Eas:ylPnҽ+ugsfxYeO]/gbUfFb||UctF{ō"Cb\1u y)U.д: *ʻ$F jKY8¯ԟ>L3-f_[LG1eqz/uj Csg) C<&> IzƒPzzr#cX݇6Y0$mɲ - [:x PRgD΂^J+ ӡYT!Zzs7|KoZkwibzczǶId;_/RXrO8 &4!{ԍ 4TA fB;;>;:E^Ag'%-6ASh7B4>dtQ,dQӀ>ꆞN%$'<K{=N!o&&N%'\|7/x=-I3=* '2'Ȗ 9`},5@t]&JXHi1{>`ݽƊ@-n[f[ DIҜWh)0hI_ 3JX2G6 OPapic *$x8hWZ\oKo,EMDw%9H;RYb-aޢ +oW^X@"M(Xa\7:X{M1D/W/`l'>3}Ie5EG/ 3lr%) #BPwY/ H endstream endobj 521 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 523 0 obj << /Length 4142 /Filter /FlateDecode >> stream HWۖyI*1#>yؕd'QH}Cr @c?$\ؖw)==~qǿ9 (gQe~7qxݏ9}?d߭7V)o(k7Lq4DIԅLuS~/[Aj)bGb/I-~`bۙy ,_ ߇hwtK"4 OsY5{EU-:ԬٰM-O콨VeݱKYJj{Hp8$YXJSQVՂڭ`?5թŮVs;d.NIZu' H<$@9C-Vi`j %0 81f`yۿy\}{:`K}IR(x,QV;*Q<{~WohJnq,ذp<ϲsp0ƕX+-HSw ܴ~!ۚ=ܾvױ1˂?2+S)U(n JvTݎ}5rc b\ɟe_uVz[o*ł}J蓨e`(e7L~4ֺ`85iӜ/}ʑ8,哬As[_N<{A؈,kZف7^-DJYkX%eʹw8d HX3j..^;LDUضʥ,F> BbA'}/:z#,N5[(eO%Bmb&VD,UљZBr1U;ux~Yԉn=(z:Pys+d0|~.YanB"ͮm1`l-4;5D7@ےx94xt:Bkud&Ǧ&Q:PTi}:sP:)$T!`?{,QUal+ ;uD"q1;`X`jJZ<wLKXO]=J;ӣFnćvHDjX!oΦYN$^vOdpQ@p+^ % S(qG ^, \nM,cl$J+!dqXGq%?}&024)ɻ@LX1 V@fE?`\%,ո_z -ьtof 6@S h6TAXnn۩CA_eA}cv.b=jx$ϴ Uqk"%aʒ ?mvtENpVВ֮TDݫ"{Fn!T* MšycEE2?(Aim $[ynO[okЧUI!hzi^s*0\:4h68)Jfy18q@?w(8B.(aTlDvn~šcM_*]c^;C-NhG#]cU7HGWv= N,d)v[)45d-zjMTaey6%# ܈'NAtOVWfo}jȃ>p],R/ XsTvm Dpcb}10\UM'ߙyID^O@ m6\BgB[X*ZBYTL=BHCK94і ʼ|^ 4h r{MCbזXB7Һ|m[kq峟Y I?`x\i=m|dт`iY*ʹMiJ,smN:=[{AO2g*pkI,gF494j4shUP`"7r-̂PE2 (F;Q}Z4}?#o0ݪ@4ܴ=0%Y>Vp*LEbG+v4>U$kI},y]m ֠nEwɡp8نFĢDzozd:Z*li?kD#8_)=m2M W7.`J=x΢P*wQuia=}w*Ka?"G!]mFÑiR ?!EG-l^9]Kj䊪\ɑÉBw@sd? 3x:xwd&~Vy;q 7udd^79o! g'R]R,ph{ i[ ZIQBql2كf עjh (=7d{ؑkxnE@6#*ouH} 'R'H /qOce;(KxfL8k0g ƞL|1(Ҫa/dq_LA t`weODž|f/04l|9084@}\`sn}I endstream endobj 524 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 526 0 obj << /Length 4694 /Filter /FlateDecode >> stream HWnJ<Bpxak8>1l "CRsggH$ ,Y"O>] vx1 " 6XG>}lZ`lq˲q牬iW˹,٭d\&3pg+X_Y"vpvp |Dc9|YX]P)g%k)GrNKZ,LdE,:߶,=>Q%\yS9y94㖈{zD*6~c3T_,44ݕMⲌ*T?W[8Z⫇Clm\hb8)v ԟqU]YG9ϔL`R=.e)tǪ=Gijdh=_e9̻AFשy_(±Z%"+QxEMlt7mS;w3˨=OQV:NfT +Ύ5wlկ+|&(wֽ+CI|J)L }Qiբ$yhݽd=5K5yIgi9!*vmv{Ԡ<-Lߊ3"[Aq3nV3E6HEj pᜆ@vl)^͚33P$ J@@Ȏbl@oz*{W D|N^9qW*ѯ%lNJuF_r0x.b/^[<GTb@w jt$?eIxI<\- YNGFT&RbH>Ŝ(5hdʈ -a=94x\ 7' tmk1hHG fo Y:R %wi)2_QRLTE`a? fu/J6zRHA;ɑ=QN\ʦIH< -_D3d'-}g(=47FQۿw;!\HNQ3oyވ(@՚\ V |_BEιՅbD FeBj8>@[2=^f_{NI 8X]J帑muA}yQK^"D^Կ@/`k( A@Ic*  TgVTBR"c*4L8ʫi+!, Xn%ϫ?+(6\fe,bHX,x`*EŔ&"q7yq@R|5FnofN.ol]dg\fUItL^+ї,e8y,vS'K֛l146IYX`z^{]˹bd*h;36"VE{w?:_,竕 ;# -VFf'u^>ox)!4D 7hUMTQPugz&.Vj0e!gۉ7/^_Z~򺶓y?AXk'Kq.ay_ =4/)T80{a6.,wuW>T ӣ}_8ltoWڊKK H\= |MR+f~tU\Bͪ, \GbWY}qع+vFkv ^˃Np6d?~M!^ f g¾eOx{Ǭ|yTD"GG9z /ىwSY8vϮ5UJ }oV:0Ϳکz˞F^+n])&ᎅL;D|ȑ~'a嚋J )TsS&OD-ɨٙUW^z٬-@frٝΞ$8 ?؞bĪ=L@|[ս:55}|lzc$B sDͦ:;ePˌrϛFV6<,ܸ%hs pmM̨F'jB8fNy_bZ/Q/V \V/XęUSyEmN q(Jv'^-4v4@Y_E4W߫ޟW +S/y(%lkCcCx,D``|n zy>e}"Eէ~|,QѧzOaM8Qx&NEx|!hߠ 7XYRq8 &˗v_4o1ik_Ob|_?+f7jwTN= endstream endobj 527 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 529 0 obj << /Length 1042 /Filter /FlateDecode >> stream HVMo6s*fDJdbYȅXD Yء(E.5_̛\-') I8,$Xz(l&^,<"QdJig˿|(Dd$bC.5ue[ F-,/V+R( qP&0$ORчܓ,' VR 43PP*bv$eQ|PjhVn}VI@}R`l`b4q#!hOj-B{ƪUY(^:{TrnW4'+pn*oKU5lM_Q EDp͸Sjmv;tTzA *BOVh>rx6%}('̲zi6\[] ,*@jelolz4UYǪ١·j *-G԰{tֳ&dxoeq䞮Јg] w$"G4y냤3hL`̂W!0sH9zƕ N ys(w8 a$8ytN-$\2s#s FYհG)O{u]__^2&vXU_Е5fί .@</AVwٶeۭǦ<,Y_R]'+Fn+p|5dYrpg<Q%lO.L/Zh]ڵ/ Bq>gn_wUٰ(>E~k^Oc7$i]0]YU A8.3e1I=xt_j?S3ԥD@V}{&#*ڠDtx,kiWPyփCTc4vչR[ @bߕڌQ5@flesJrd endstream endobj 530 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 532 0 obj << /Length 1944 /Filter /FlateDecode >> stream HWn}:GGmM6.E1))Q_EߧhƆ  +ܯsϽ~{I]4,ƟeIy<8/vݷ=\|ǻEqmoۧ$)JpK(N׶7tظ;;{IŮ( EXMPeQMq: ].,bb!MYZTQ]):ʚ&ݩiGygg/?=Am(-a K)K ;)8/?Ȳ2E__>} $1N! V%Yj qUǮaZ1CQwr;Ji٭bS/X4)Cq" I(( WR l[@+EGTZ/+xr\QSQ(q *ORuݵz~&MIʢɃyeH_6c~BNvNZJ>A٤5+NR ^3%\j(Nl{98ÎWg% 姈y/Xˡ fm3CZ#j?<.6IUuVBJt 0VPC՞*ry;NgɱCh-J{XNL\!YMK )ʼN/KT =:VP,@FG/3zDl'C V*b?:XRsG0l+KD܅ Y1Nϲ,|^ cP@jwYW˩U9RJK~G3vA22b1'k?,>䀜 =<|<0^hߜDhI|QaY14`|iϥۋ 0> /ExtGState << /GS1 12 0 R >> >> endobj 535 0 obj << /Length 3886 /Filter /FlateDecode >> stream HWے۸<)EG&[NVRyHHš$Q>hg i4^\;3$ΥOcm9 _M*g8؄m<ؗW~0 -l{~xE.Uƫ >۾wfe^]xSdުFG#J,Klq&}1_]U%yvDM7fQMb?dadۣ`?6jȃ=N? Uwa4S^jxSu5%N!s-=6s&,`S KNէ쏃d< FDe ~M#9]A3@ u`96!~Ra ^,Noƚ[̃(J6 Wf5EXcû7_^U8"$˂,Dj:An|,oĶ˽d/~lEf%+_Y"kzrTy?M|mxqZJA +T+QNǷ ͡xOGld^٘x_VD)z͠݋Z3`)N@+(hJ/hj{ TAkYGD ; ]?tƛ4BQ69fmZCyg)OP3;kN?QDW`гZ-DcRlX;7sw0Wdǎ0@S,FRe1:̵K5q?Ӥ8QiW˙V˂WB8!{UH3؈7ej\/sK3]%F 62$A̹֓)ToPQ#=}_1Uf,`m]Amyo'ێos37w|Ǡ\A>1||Nb-Dg-s{yl+pXJ|%%vl0Om H m<^w.fa;M̱cBwBWM6S0);;V8l, (>g ԭPEff%_3ӛY2ۭYOH9jw[ezba I6ta&e)N8uʀ,zva:ٓsmt+89`=޾0sZlEC_c7>0^ ^5E@9 ހwkw9ڻ` fZM[Z04S'#Ncg*JȻN90(#;vճR\VuWT:cא{1A#5ov$x̿^]je1۟$$ʼnù[:`5XrJEW&7H2+fh6q]QD.QJ/y75ݨ:!ng \wzSCֱj$N/).eIz1H\־KNE9kzTarsU6e%] 4==Ka/bcrYݶ(Y4  e6tĘ\(g?sg3CR x{$;,dkN1(,<9SYyˢJxnTS%+ gZet)ý@Pc%IއJ9jJy=0-χ7$npہ˘QJ^@&IǹV#PqzCAP_B#FjC# 2T{Kggq7BNB* d6[KMK3؏s~ۋ4+[OI\McVc\u?6:]~YTbd>&iL[D7͜T68lGQpqm'Ȑ&4ejJ:sږuध&GM X-MY |ePFžSKBҍOWcE$npzVvI W2/HLcSy?rR-JǢ(dFڂ{k%]%vوcӉOr#[KPÛ]s(Q| "%SI6&o+ji>=ƺF¼j0RfqpkG Ma1]; dG_Nvi:džt.wF$`?w5`qh/ 0>g endstream endobj 536 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 538 0 obj << /Length 2168 /Filter /FlateDecode >> stream HWr|$@ьc;')V 0a/y̽/t{4 vTǠ}\L>^SP2yJ OgF2;LT4>V_X:}/x/e }\?3>]]m{Ʃub.c9B=GVJ\U#O"+S}Ϥʼ_toV`17uwzu/j ]vP]=T*  $Uf\xU "q_]A[)r* >#u-Yɳ PY=ة_| " ˬ>/d%" +'7HȽEx,-` 2^liMSQIaI:I& AFeRyNjLC#XE>/# !4ImKA?J-w5ݭkyníj1[0ۢ~Mb[ҚXd2YQilxL>Py0!5,8u& {H}Hsi]Bx㣈 cu^խj:9٣fIТ #ۗ7lJUeG;Nw"SrEfy !ݲ!z VC̵7;Qwe׵}dA&%JL43^E8y5O{Pݖb Hu=R녌4t4( +(Aڵ:f,O/MknǑ7 ,7rݎ3䢄ƽ Clqjx,x#s}2ZdB^`o--bSGR烓R{>7hvhY:Ģ?P-s/ 3@Jt *zpGtp xuN@ORTu/7кU) |48A~t8j_:L\ [?yW gx$©0u;\t.kw8`àvb-H ZRRR:ΝKq#>* )Ne+9s4RCL7˄A~K5h^| :Tc٬BvsyN0[%״4mML+[wl[4﹩Z RޡO;qgj~;Uq iIȂo8P!iT&E򀭱A@@ 0=>ǧ#)s"hpq|zȲ&U@ יLtsk t''6楆xuA 䛩*a]TZ&sNWUfS4V3Dr6_alD"j]!0Ey=kО=5x{cLh7-K_,L~f.Digu;: 0RQI>:?zǪz9liѾzg/xWgV:pPG5_3vS'^g|TɍzbSj%j>&13sz"FIc=fZfzrߋti:u}K.zwS>EX\> /ExtGState << /GS1 12 0 R >> >> endobj 541 0 obj << /Length 4412 /Filter /FlateDecode >> stream HWr<) yxm,:[8CpHb4GT%3)Ne$sӿί~y,`U|XFM36 ԟlw{C|ߏUJD^FhN(/F898K'9p gx<ް/܋JԊQ=R ↽眎E}0 s5ES]yui,V5a7c 'Sd=dØwٷ5a|AK$?K3qjihRP.F\u VRԚ>=ImT ήt..e((t@bA(PLͭUi m1xijW~9}Fj-s$+;S*̜ r /?$$02'u<-hAHSodenT6h{dÑ `+ֲ4Jx>B;Cw4% R&|QmnͶjIs֧JEáH4HkO83:m1]):.2LM-oVCS,ABv ϦR=3 [pS:Oe. Wܲ}RjKO#.{WQ6++p˵_hW 4><4)!)/c%em2. dEvHxUqz$g+RoqGf̤Iլ 9עFkRnhSk9Pإ0;ְj. :LUhM(0X+mZ~|9{}o+˻,F>}v?M wX6!ri-)!nS0 Ԕ˶;m}2Jho60Bf06!+f_=lhÙ[K]vjGt \evm?#|/^`eAABތ^2uOr6 H!ۑjDj_`SB‰TIՐ `4˥ҧk ƴCQ񳨭uxfs]NB(TPivU̺;3W{IXAkc * eԸ=Fij$7U\3@<i:d;kANʁ?M`ak?TUMi>7j[ ,:7.iJ|d~Ty+K71~ʽ]T$Xily]ٰk[L4q)ѭeR䕰';5殦pU"! "* )ۭ}=L4$o`81 6gP9Uӽ>څȆ37s>-c*^ /m wҮX"?;'8V63C$#i|LBy  GRs@w=[7Cw)mAۭ ?AUP=@("ῂ*YfE :BiV aZ޼'u*,7!diU~l3q.nD-p!j]Ft^R+4͓N+0jP `)a'9dě8 `5 VwEe3 9HA4CKQ*zj0Cm:#~n[ǏY xrsjȓéPwNW}g`hu%E'װu] k<5UoYP$`qWp`1YxTG$ZRB,WrcD5z=w.mhFpYKq*cyJNA5MjiV $C? E7i4B˥J{uҟ~]Tzo=uL#freŬuOIG؊2`DBv~ݐsИ@,ެE~h"GiԨdvig؏9. ږ6ӍtkޑS==c U t 5D,S$PPCVx*Su4^WK%' 9I- .\ʬI*59U#v TDPQwo.Z\c- šH]~8Bb +1K|b׳c/FFD`&TYwIX蒤<I'Λ7gbW5  CTvZ01&M` U)<:#[".7(~\piL?<;FGyq~(ZAϱK."JkQ;SXܼ 7"-H{s/!_} R"<6cVXfrQkXwn"gj7ky uֹ% E'ˀ7Aꝧ/kY׫͛ ,!tNm+~0GT2W[g)/AM9jŶpQ{qkU |"Ug-> /ExtGState << /GS1 12 0 R >> >> endobj 544 0 obj << /Length 5325 /Filter /FlateDecode >> stream HWےyMXגb9v$\^? !9ZCcRLR Rs7Q",9KQE7y?VUq3 0 vYy]d;SaB ;t7U'Own2G6s<#=ܾY̲yƦQG$5/H6 Yod2m%s8۫R4GHkkDBV<ØXQciՆ;ዶ,ZռKDpȂW˄ͶCo>C|&k-娔FGhjwJC+ 8I,Z !>#}+3Ԓ ͳ{O-O!Zmw~F~EZ?%Aړmk;4S:#tTm6LjBucTO78 ۪9];x)( 5B}8lе(x .C0QoVt VxK#{r?( VnZpAg,![D<#I0 uҸe~zÄ-WǷWqݛ7(|̣<w>݊3 29QVR%rۮ-v ZVSGUulU<{ KNQiZdnb_ȡaVNOX"i'¿k0x_UIf~ų6kgYlm{.jۈ~GgIyQC7qms{`Iل-}$=imRA@TǃT=XJy2 fH.QQ 6dv\<ҙkEⴆl'Dd|XE<#PxOup^^ FwDQnmWE K/Րrt8MAhhUFZ2ʔ8p)k+ZJYp 8nD̪)as`_"v[܌bg7HNyli[pGYB\a)։t]74F汭/+=Tl-wk)NYQ/o AfoK>w%,ȼ$[31qdƀ਽NT$s=o;HpƿJ…Qp Je L^1M"Fk{9uv,uk@AW8>_@fɶ[BJ ZWv#\DFh<$1b yciBl&7e=ZnsZU dBVxvd:G_a퍠ŏh)G܉&„~ơ%DblEF_ޣ YdE}IBNЦNguΚ-;åfp\G͇ dRcux~< ڍz K/8P:(\ظx^&{^Xg3 &8bOG`aEce~yOwid,Ǽ"x"!B#.$"a(l|.T'JӾC(,t MeĶѦfIq:\Դ/O  k'EKh=iZYKu*M󹛚[)*&3Kv+-jӦTb5פz+Iz{&Q8>·  mYj]4 ;Jj㍵7}HC;HY1}{Tv^o*`Z2ފ(l/|W=6 K^t[TZu"U3Ҩ*һ2nwg͉ΦEQn^ۆ"`i*SAyvDW5LI=v xm? LyA{"dv,FP6!ogG|Q91+x\/?P\8(mpSEEZeR|frr\٣}]{^ᮐHPI!nZ:u+b74DNcB{)bwμ9 <^(I%ce\f w̹mM@GQ{\y|6[`v] d1_߬YeÎa7C3k)e蛧O,~.<S7!(L.E,FD96h1$*=$!Kkmx(-W,+2U[T!~ \XLEȐ 2 nw8+4ؖ'-޷3kG)va2v;"W!u<}"vp= %VvDĆn$\UM?S1#-`v1.'6Jt)#S͵QX'gf ejmJ6x}K5 ,HMTݦƊ$N.9Op3VOI>;3۶,AavfΊƅ>CF^bI[B母i)= wxvT Mz=WJOPkO,ty P;Wh8{Ӣ^bJll#>#4!2+z.L&J8~w^\Eihɉ&s=Ϋ>3Gu(cF$${&FA) > zLB7jZ9#&eVnnW <3Mm4'4oE ?yC7u Ki'Dx J壺CXIcBXPұAmY/Х%kڂr>1M^zv] :z(I@AB݅R6 jn;PMnIG'E: س`h,a"_ -887u2._ʧaðymu8CgUi~c}3-lDSvw%H A৾|>$y{fdڏK@5w=^x^h Kl"wH|8H@MVk]\aJ$&>v7={ xe>k rAKX;#$Dnɣ#@ hK7p-VfGP~T)Q<ƈKP?r6FPqsFdP,uIST nh|W 7ghuƟZ܇ݛVI=9-;d] -%;h%|MEQZ_jociǠ"Xt%^.Z* ڢ3فv&< DpK"e<;(MrQ\EURT:M,j1ScIߔqn,K#!l$1!ץcޱ1]1hJ( ^}﫧JWnQrMj!ut-~ ;ů4?\'-FklQkPK[x?$f endstream endobj 545 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 548 0 obj << /Length 5326 /Filter /FlateDecode >> stream HW]sۺxȃܑ$@ sΗ;'h\ KRVvz N:y,s^N^ 6[XeJ1KH&l>o~7*|3D<"f{NgQ(LSgoO&w!7{}܂}*Uoy]vlVf wyXY/eQmݼf{W!" nm| l͋M/\2JDܱۖE^͋ݦfˢd%sW7V+Vg5Ca᥿[^;qsWUYlŊ%N=|0yl׏+鈈 T.l*|]7pCڹ~[A;-Уa7T.[PP-KVl~_TYx +O~PX\TS|Wn3؄ ,*Ud6EFqzaUoڡ]xo92,٫4nNxfgM=BX!E(>EPtHKc*YA\ʭ_T@?8YS0SkgOD17Rh$2&̴3I6 Sp 6(<H~Р.6Tj^geO7%LWnG{ڂEoZ-3_`p$U³ "2)O96i+ ʴsҜ ٟ(58 ;dd$jGţ)DƺIKMu/v^ 7XeŃ5ThEYx:c' /f/IRn4Ȧ'(" àff!k$R6w:M 2Vf`Ůd˼jv%ɪM0&nKO$ >^b"xŵҲ3o#UݭR6jBEx&˻p}5&oҥ`"Y@<=S:)q)' o^uOLb-O'$ q3yz9*~iqيŦ{#Mi9j}嶻r MjcTz0}~A2MQt :(C $t0Lҿa`)z>lhhÄpC2q`Rrʨ} +7<|Ϫ*FDJ-]YxQh2”vӓ4ԺƆu'@A2WAK&SnYMI:wAS{ edCN8;D7.fUՓ -3QԐ?ؓDI@߇ yTt&.5eQ&,6"IL~6Q(O?HdLZ/F2qb9t-ދ[^rn`,_`\U7%I~8OϯCH`r>&k\¼;ց_Ot€%Gln4Q 2< UzaM%z c?h*m~/DO Rd>72t]@Nj8#di4v5sMi&F[.m崿n"^Q3ÞH;\3{qTr>6B%{{xz/ fRi]{4g{UV>)]Yjr G;D(9tI.ge.sBKm},gNIԸ(D/-zWY{㋯d?Z|hd(i AJ2C`޾|ǮٗW_]gW[} $ |/_?_6LY,KD-\7ŗ0Ah'ˇ+1}{ $Ib/K9+-`n|.EE~>[3T&s GVPn|Sw5tƠu?ƫem#~,2HF"8d/2Y@4U 4(ʓ*6q֭Gܱmo68xʢۺ#>m!8jXX7==spb3kѻ\ Eoh .B75t071LʫGFy̸_ra%YTEn4*ٶz١vMUJMRقC-mX7G핧q(dLYs s@3Iڧ{k; ;lnfѪ# F+]RYv)rwN17K*AEK|]*M%g踤!3>#nT\;O;gQeY2KfN"QFݭdu#_pօRO\Y;/qR/i 9ǙvXKgYi1nʙEI$+'?XYw˻חeq%Hgn_8yaHdu;Տ7=78e{ [08q<} WG^s=6U,<4ꝻPQO *pBY" s끂e:+09&YG{ [B+vdQAG7XM0~"GnHZ&>#_lm8#g1iD`|GTץ"Rz"V#'rXLGlFn[hX K@hMm3-[2!G  E|]@d7y>xRQ9H~lL [8mPi^q{$~o)nWT;uv fHsmS5"绗\AxȽ EF O5Mi0?Պ;R\EsM~#ߡƩ*/DHK|cYhok:Qo64yޅqc;ËF^B y͉YJ-tlBGӥSv ښOͦ;Lgż&T g'ƥ>V\Ew30mfDP7.J_ԲVPEAqd0ĠŐJ*Tj?)s:t'J1Ja(A8BDΠـ7DO0 CZ2.|hS| ]b#C%z2^C8R98r Tˏ(8i6(\DUXK{տFb: DFFuj-Ogɢ"qX|@DA˜_fKt,=0 /$(Yl-;,Tr&YҔ-VΒl z/:<,)EߌׯgALū (_J;Ax #K!mjJl>34_H0)dˍ 0Z endstream endobj 549 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 551 0 obj << /Length 2719 /Filter /FlateDecode >> stream HWrC8LD zA(ǕW,~M 6 (Y \Ѥ\|a_ܾK:zS|5)Y_d-҂HR 6NR_&]sA/&4I&Y Ww7Uc7 HL7/؋Ϥ;ͼLDr(6b\pǠYƓLͲIN|ZMGZCٰ}`Yuonj;aw3Uo)Ýa],{җOD ^ҋ_ߑW>pjFVwVC`ߚHIjaٵ`p^n UB,1MxK+t]Xr=[~dYWu욝&V$7,ADeLn^\RLvd}ݬ'J ]k=̼~o Jɦ} K¾uo!";$ T84pl;B sqBY]# Ջ_Nf" 䢍R(](QeQxEh#~;ΰ:uzCKO"ϊueR pdwfg"dP^ ٣K߿vMm 7f0jg=fG|eþA@ CE݌`eYkGGR)E6m,6q%İ . 7g7=`abϦ]LrwTlOo[vSb xh-5;E_u'6q֕eK7ʝPoS%싦LBQ_ :s@~RU*wsq iwmE{B&wp~x0D!.3Kcȁr (Ccqh5!\W#]B V݉mNk{CdGjd!׮Azo<'*)/Ć}}O.ա.Mꝍa? P/ 9K֡^놠HN6ULh,Lіl"\o7>dU" M2Cwi4hmswl^a B".]{Ż~TOZn?X}I Ra(H4/s(.~̟[pR8V~mk#-J|-SyJ -AΞi&J)=;Sg:x(3GFk:1G Ѻi0,V>D;/.qEgXܒϲrpfcnO؞u͞sk"QRM)g^#X[z/{X<9k;/wCQO₞?(D<:͙iS8_:ܚ[A{#<7nb{HI1/f>uY0t1j9fJ5KuBè3X3}_@O)[Fr?hdLB H%P"L$*bOxLr%bO!o&kXe%FYb` 9Ber=2H řLK AFrgYxtR56Ժ"KՕ ͷĺ(JfTeͱ6k2WtfS 1"ȹ'e)RLxjLpŬ()b"Krt=P$Pa%E$'PV<(kpbwO^|5G``W%E7RE'/ ioDL? HWG+{.]E<"zO@ךC\ w.݆*R[[+-$c`h$Ǣfkb)C[D514-, ,-La,k,M 5T84cCx@NU&9N]S=# #H 8@ `U endstream endobj 552 0 obj << /ProcSet [/PDF /Text ] /Font << /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F12 273 0 R /F17 364 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 554 0 obj << /Length 3053 /Filter /FlateDecode >> stream HWkob#U6->HkKϋ3ôj+'TNjQa˕hr%E?΃rW0s{k8l<}ad4KrB_NdfLI和Nj1:ywq hДR20Sh c)ZѧIQqYdIQLcZ-ˣUAF~9d\M?X,rC mPTn@4gʁ<=Ō[H9>&uy\r2V+rRK2[,@WC,6JjɢӢ>?zZk[- \^7إcrȔ2r.kǿM WYjev-+V˶lgY4P~ [ l/NK>P.fϪiyQNϡYgԢ>|rt,ݾB0D:ՙ~*σ#RJ=arȞG2lא?yD#H/ot>"*K\Ѳ6 :X^x/=ʎCl|q8@4<#!{~wR&) 3:y!OՍw&A}M qGÂ=c#谼JB ͡a !g+ˈM!`oi HvL/Vx2/#H!XHbr%JIQ20bTZ:33~"A )Ɍ/<*npI$^i±ٗN/Ot!ۂ׫jWiօʟVYk8=Y W%RSiC㪁_W|씽9 m} uGG+~'YQ;(ՔQ!I[ ֓[WBZ1G:PK'%~9FAwp 0?%d@Gd)(gFH?CG"Eh)2J@prZ@(ID#x Hz2֩؍Zı{s8eu|3`N5FX󡧫۫¶ 1e]+g (!҅vָ3}o_Ej`K' endstream endobj 555 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R /F12 273 0 R /F17 364 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 557 0 obj << /Length 4869 /Filter /FlateDecode >> stream HWvC?9 5^%3v"3Q@@cig?Uش$>96 [nz9E Dhx߈uxmy@<]C lӫ}oReD^2]qMz׿_|'m'ρ$^pxu^aD?S]!(e琂ǻ~Wo:xƦ-^wU&TYMBS)$%LW׺i ڣT#c EoB-MGI¶^"o/7m.RO^Tª٩lZTlr7;O䚴ÈdS @C%>AhC1Zkd#bx$`9(G(QM[Ĵ "GYתk65r+glh}!=[ E"uS0%3sK/XbN4(NӮ/{W7A-C,hu)oYCÁpT2%RyfT%@!_ ȟT֑E1ksޫ( *$ʼ /[wpA?m@=i]+xֹ+~ssp0;#k4yxhOq )ޏQwPQLa2k>lOđĶn,%0fN:bh{瀛6!-jő1CvBbh.Kea .ޖ^NA_IfA!OЙO l>X wjZ03 t*<ɪ aU KWWhDs%1oal+;T 1%V rǨ׌]A3D,u 3g􀢐S*9q9ĕM]euarlJD P@pa3@ˡ #wwጩBYrD= M@^b.x:Gʓvt*ؠkɒUIý̄87`JVxr3`Ϊ~<IV?CxA^l钠5׶O I쮤W4kFn^'m>arfyz8Sl ~XZ{w٥7!;*nt,QzF TvJJBq מg17aeg o 7Ɠ EJ1Vy[|@k&+M >Q_M_.7FtǏtbwy\XY14k9`%*0GxvȮϿU\PQ'jZ\7PJݧ[L9shJbp$6o]:!@jGj9jCtѮ IeyF}S]7d qt+$&풠&-L&E&&i!cVGFBm0nrՉs}oEB#I\$IK_(?fEB5&_w&Jӧ]Hu'!KŶN6KXeՔ,PP>&Caj-{ghd 3+,ج 1A!nָym}UY!W鰰6;vgh47f6pLYBݙ'<*2ʍͪU82 /I##E8׾N`эe!#6iYTWe{b|~@f1Oh+EjΙ29$ B'Tb)&[,6{Q=8%'oY s kd.x^zlj|8|ïQ |'Mԇ%qcPyD{!,Kt{ivVA ByL$`jdpE>kuIfAx:͕']W2t>f=*D\=y ostđG& V):ԧZd!.9sr^kZ|C]rkp82 ӘGWBOxHT]%L!Mt*SB؈`A傷@q*hGb܉!B#x'BӪ=S9_9Fm=sΓu> y4O0F+e(9>nL˭r0YqCUg,nrދd[2F}ғQ}m^"]E&9/GS5i[ MHW%qȩfǝcM^J(tRPL/qtXKS3T3ōBEnqO|l+X/2CL+<}]YoDh97a8\t)Qi+|H=9ri_盬( _>@!X2pMChS%gjQo ZTi1a l0L'Dhȶp9VvnjSW1Z @yXH',2 D~xjI@*Etg/&GSeT! y4x3=39`.Aِl@K@"=z \oL7%h#,PF:P~O is8Pa"`7Ԋ#odqjM~7dJۃ DU7xar&p ԼB#kFí+8[ձ%E5޾0Y0F1/hD'#ê1-Eŕb(!UY53g&1ZҤ^OʇY} JvyUf]*}D [9=5+c9;D<I%zyXVKչt+&/6[n۵),6MRSÚUx-732w\:@]L-,+cǂ i`bOhfʵrjr?{Q%rUJ W'iCFA<ߌ:@:`j,wi.;- ٧φO߬Z+s7Y=^p}Zdݫ旑 ~?vUrRlPXݻHZR"JA>f7TpӮʢ*.9~X'F~6N*>.@dIЄ/VVq~V/OY`9CVpR>b^;Sh endstream endobj 558 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> /ColorSpace << /Cs15 559 0 R >> >> endobj 560 0 obj << /FunctionType 0 /Domain [0 1] /Range [0 1 0 1 0 1 0 1] /BitsPerSample 8 /Size [255] /Length 675 /Filter /FlateDecode >> stream He۶mٶmuٶm۶m۶k@ A`!P0apH(Qhш1X8qx HDH$IHdH)HTH4iHtH ȘLȜ,YȚlȞ9ș\ȝ|G>}g|W}w~O~o_ endstream endobj 559 0 obj [/Separation /Blue /DeviceCMYK 560 0 R] endobj 562 0 obj << /Length 1713 /Filter /FlateDecode >> stream HWr6 x|ϵv-M2 JA#pAʶuoJOf4{=8M^c0-& !ʼi>hFۛ)F~3K'>A ?|̾~x$#xqv99YQT9$R謪T׶h\Ex1GwJ"l%:K bQM"w\tᡯy!>{3AgZA_bh*7]-Pad 6dC:fac&)̊%G+=^NNnGk H'$gܪH.LxQNu.]\.Q/˜̼&D}RB=90 n*_zhZMvBڎHz ^ߋPF)E%M1B0Qjq;0t!r @ cZe'FS4thG~>Ib;>(d24Y T6iBe{B띃ΎBCyVYY[NB8zFnQ)^V&ɫJ(bL' |!h^O06>hD,*ǞO_,4ɐ,1:{Zygeϲ"<@zY*WwɂzRmoZ\-G^u{lǴ4$B"¾9 pt=(in1>1%1Kƣ\geZ29F)EAr"Gza-E'xQ0$f޻z~XA[m >y,R'9fZE#Tx d\؃H/2P!nbe^ًWƞ᱅铟ZMHGoÃEaKuXM p-s)D1vr.ކcP!}5Ic(@T%TkD֞-mocBn,A#sSGpăQ|:"X{ EEFzKH> _j/SZ?P,BVC8i]pοfZoKQO=Cc b%+G |Lڡv:Ikk HѰf{]Wy%>iM`0a`BwwSvoԁ\'ō7Ӊ<E?Jn rQ% _Nehx E3nWFэ ݖՒ6g8H=/[>⃿ LHqL)YispD ""%Go_ _&/SHŲZ[^)_OQ <ɥ01t> /ExtGState << /GS1 12 0 R >> >> endobj 565 0 obj << /Length 4462 /Filter /FlateDecode >> stream HWے۸Й %7݌Ϥ͓ ekSnAY%$CY0g 18 cA|p@$_#n,< YE j;v]%[mj!q*xPF;l[Ԗ|2BE)%[g1lJZ|6}jlnOlŧVr&"7Cna⃩eZ5ṼִE28 a%z+y\yL+/ZTFխh|C!-e0uۘxZZJFz^).ZbUj{6Ľ{QhK [V] G.V lk]V+v9m4Ysauyae+ FKs!9&~ԡubݵ{VQ~AMU 8,Af%nP7:, PVӃPN8Cʃ35:0gY8q]T}N6U?w@XhD%צqS_aY}ѓf޸ZHeȄ|r08q-*lx1豖lH(*s1#IS|E~7@8hݝf۞*%ܿ:6H]ї;@ yrޕCH1hpjŃkt5Ӏ-Ih U#̝$#G/zH-A:.3]?)ZSh7֪=ϟc2_ sԤac̲kL $IvDxBd娕[MVg`d"a8D0uuEtv#^R>i3`9D8sl, U?hCୠr9C$..z1[ %@[ `GAVA7|y3}9DYrw,Wߥh'c2N}C^5(d;ڃ8& ve4lKc1/~.JC?7J(%~sa¥{u[ ڗ z:O;b4ya;:^JצEF7hW L(!lpc.<{`a?]`mQ}}iF)!xhpgNKSҲA|iApesmdp#eryG;Xxȃ_KYnW=cDOaKYA6,HC ^(^zf̣qI wv{|teCТ>b j%q ~rX՞p8]o$1Y˸fU9fF 1`cٙ\.iA"kBO kaޑgBXWxf3X}v. gojEt$H,)+mQm^y⹖k^ C}AFe^ Rr'Эḽ֊|Џ Ӿac!1 y6f Z>bhF ms,yq9,)3ħxR" Q"E-Y Ti[N01, f6btw p~2a朕4;# }2rvS9Rrx0al6C,#Kw0iāIYRgFm ~HpG(54aLhToŶIb}VєlJm24 B]*7NABq/. ҍ&Uu!^]NS@O `6Y.'IOH]͢/ о)"\UoD$GJ6': M8`rZWlk$A6{fap&II0Ue}ސz1m!xIyST]Zs>6}V1(8HU)ZCb(&Ө mBۖr_p\@'z4et3r+8FSxar8"39>IzJn/*v @Ž&ߵEJRT~ꑭ^rS OqBۭFMOI g S|Ex웊Z &}#ָi hx>=pY"= vTXG;$}ЏhBq c塮̆9K1)"=K*kfY94:_pUhlAn2Jdw|c!9EG"563T<-,'B0ОluIAfx xg(@KΣĔ@^-"(ULX>NyZ:`&gfzT)3@EN<#ƀN,4AXb}Ċ3J-t3"Y4jwp^gkG s_\9NGcRRV N'//,lSξ8ҬGDmË\xAI2GPC^]o%0)=G[q9 uedzrM|bI9f- _<h49/i)p\S;2ݦK?:pwH7r ]h\vbO5lN ë.A=7'sBȜ̃=N|ǫ( gۙB@gRm 6UwճqybQHQ稍aط c>v^Z-h,Bi`?#N+3W[y S/Sf)CϤB\vKϘQp?]-]= v3yt2\dXx8fTbG@^bf ?O)Ğ[ǟ.< pL<D\/g8g&C8Xn]Lڀ= N'/Rf|!()tEH؝˖M[.wV覓0ПxhΙW\b:þbW|-R}[DQY]T:s#-rğ\A`>7c7FkU?Vy'c# Sb]j LJ2.x? Яosl.Dza&dpzEĉc/'B-\EպE=E ԣ]1O`n+Dh*kZ"v^~u5OX endstream endobj 566 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 568 0 obj << /Length 833 /Filter /FlateDecode >> stream HUn8S@bHJ&,XâVf,neѐ!)%cB7f7rvd O(~,I KsPBQM'e5R*|]1.C3q"&t?;Q-v wݾ nצ5 k*f fJ!fHe=R}]UI3޶|VntgAuiU)S_N=Z7Mj{zŊB|A(LdlsT>Fxlaim vEƌV+B؇2:m]Hp?8JNY;>*&:K.K}].Vz;T*Z<^'i#v# ]mɉE~ DO8x!ㄦ$DGڴA+V]ڌ\~ciރ_,? w|(GW1Vn.pw-ήӃc%9֔IR1+hMYsFEW0Fŋ,K> /ExtGState << /GS1 12 0 R >> >> endobj 571 0 obj << /Length 4122 /Filter /FlateDecode >> stream HW˒>J9iZ{C[>4; ?/FC TWeeee?l{,`.g>, bo B l{ͳ=}mgݫ L_op l -x[(P%Iuuf7*A&ݐ~QaiyQGs+* $*R]jƛiXUjXww%|2>z0&d>^!Klg6 OTk#Ϣղ{E^%H`pΦa;㛷H%K8!(H~ Zrjc# u_Ojyڔ"(3ʜ }'08dBӟcy"  FYԔF"{7%~@HIf.ɝ͞FfH~լ4[;d:? W \J6(k\ Q#%_t*opb7tjcVidFwȌ̹rO U:GsLD("{#o+%G 2rY.̌ X:'< (x %BZպH(n0̫Hl9j7 yݳR=gݳُqZk=OLQg~/t-\QxH ],$ze!FઔǓҢ+ 6 mϯZq8R ={' ijxE {xX[tHأϯNu)^7ܰyPiiM^l˚jSo50-&lk4-FmAM IEۆ[5Ib:.l qe~lLQvp1t枽G%qVN~~$߬% 2nI(]'$'n_yP I 7Q$К; T9vZr]=+ݟ .87[׋0HbcM|6mcom_{ЪK_?ޭ][KbaC> Pڕ[lq2˶菴 Clp(_Q-\F 'խgr^+`ejVUe(w捴Sa`̔\8ڌ#-ģZgQ7d.l4"u2NznN"[[c7mߒ}k Ҥ2,[-wv-}&6~Y*#df`$LQ J\U)GM$^A_{A.W3aVg~Eju<= ]I.RgAh38xWap + okQGNiټCutn0׍qm5,l܏rmlkAo9D=9rڳ(-;0DneeӤVTBW,fifl!c~p`-tҖxaM)B~QP>GxI~ŭBN'#2S YqYXd AUl0<4A Tb78ƞ_"۵y@.̝z{Y+xsKM}LLy e_8ȱ`֦Rɡyuh,Rػz7(k#ņ"oT?Lb7I {)p]&z}~ؗQ>YyOh~|B<ͯTV^ ʹ8tP8Ξ5Wq^mP `Ɋm-H6!1/je:(YNED˜93$UEw['ֹujQ(XD՞f$],>{ 32:\ݢ{p0upI!lRC!t9b '242z"1X.J6*Cec"I#y},۞'r5OU!/%kq zGo3Tp>f;f!40}۰*wtg5܉qt:iުUt~ʓ5䷼4b纂2lo"}Ԫ]~ 7ĘPe_$k.3[$cs&A6J/WmkYC;2#j` ֱ_?xLr`(hKQQ 'E v.ͷJ+0˕7qJ/3e]ӁkJDX<09母:8vanDrm H?|TKfK()Dӈ i Q1NmI B׏X]VG N!@ix׳"MSbgbM4A@2rpSsF I2gЌ`y=1bM| u$aE%n9JNru;*RrY%q!+) M ;*!,NUCU`FvS%.~h LUX$CSB}עo02-p >ĥp-L}܉e~}xYX.vYx/E] |6Z&|OJmNx$y^7ьrGi>r՟_`he endstream endobj 572 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 574 0 obj << /Length 3245 /Filter /FlateDecode >> stream HWn:~,,Uԅ&=AiI4(٩cII,;Y|}a4_QBF8P&n!gyهO3Ve9y|v}moѳ}c^_ŗ\2h)edX@uKH8޲|j_Rk+T4bs|$DviHst ? ^G}?46Ae߾=7hbS}3aK?pUɒm$rn@|=7yVb<72FDZ T5g.d.W"eIGn@i_]lע&}Ȥ1Auu8&n_gu-nO?uJt,D. nbt2q1\kʔpp⒠+ ]B^TT/*@W8rU z$. 'qџSf /C&gx4DnZ6 {DF!@N 9̸*v9 濟/^jLu!ot[6KtzspbЁ閉XiUA^[CZ^F$u1`lc߭Qu#7)QQXkLMQM:{c6--O JƘuJ!#-ߦ=.Xųο:.z DŽ5I{fqakoS묚Mo6"7K@dO6e0JPT$ޛ(2DqӽХ^r@:%qo=ӽCw;,1U:{,;GXǹć2qϡ|5/)v>ctvGwK47\Sc8>"x%*=K#@9)7v4:T`HKzB}Dy6$r([=AW^gEE! V*WY7"}qEѭYM (zpѷ:`a:tԧMmQlJ-!'d3(\mTxi}藎9GT+Yן4'C'|~H20|4zS+9ivz]Qß%Ui4j~/n:"2ZnkV0fKu\kQvԆ1aߠlwۂZ>C,ra%*]s\Fpxxsߐ+Ry<[Shj` eXMU?"s]1 zj$=m}YGEqulV '^/QLN/_ey*5glwRP$k84osmfe>nLC[LS"@.?6дCR3ZLq$~Idzki`xE+M#o k<Ҷ+$D{2I0x~(c~drIBX@wR3h"7ȵ1=2B*6JB, @ E`6눼1m#! j0PP2<|# endstream endobj 575 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 577 0 obj << /Length 4955 /Filter /FlateDecode >> stream H|Wے۸$WKj7f+U%y$xHBH){>&4Jrg,~"nQJDYQ8(4cvw{Y)b{0 ns^?1;+ӟXrHb}Ppq4rȈ8H-QN;' #gPqh/9t7xzlDP|̲I170:/I/{DGlP,,ک=J:e~r| GлV;xձM l01rYuS|xMxcU@W@^ZBop9qp n#v|E^G $r 3x\~ ~.l~z@F- A!hbyiʃuzdI v&\)qu)rbIElR￸ McgjjSXc;jIeZLȿFu\M"&j#:[0HaP;c;BD 0( g$tp~Jh21EyO`Q;;E7TZyb?i7"=qYq>;uT lw=&HгGcT%9 ?#\ȞX:qj~cEP[G=LF魪#0-7pv]m {|;M((uGH.eu\T$k@*h'Hy]bG̯3ewk<66,x44<9=P /WUsC<"1sǙS$v}xW3Q4)YQVբ :-:4HY8fŅ`S'm tqXoQV>nh;j^F2L,pO^ƣCNm춡0s9+D8qux~`8دُp0UX={:(oqlV(3L ZZ?7IhVe`R pV\viC'8SD]8bsa9A?1 VwҖZ7BA$hP@rȴ:r2&B wf +)~&6F:ȝ U"1Ӊv^Esn??|GtA5ErKŕ -;3_FrKGׄVn$:% ߊ,AGVkUxaݚдGaIj?J;Xιf:)ҩ{.qŝB i){G5b{$+n 5D7qqENv$S$[Km(jkJN,piBۡyHH Y xdk$^A׽|]jp.X^5 G7RD(TUL;qy;}- QA5'̨E=J::\h};\/HvW16M"To\cm#Mn} c^]0{YcD467+t :dtsGw r!+XB),# J[֕v]Ɋ0(2./wFU:Y%g3*-ɰY\*Jj$[#ֱg%4Mc|L%^_"I}84P{Pկ5%zg T%9EA6^hV;=S<~ڌ9b,@٘ZQ<.ojhCp<7جY蛋cqJxg>~dži0\{1Fj]QuMa*"<~ivSP`_TF2`'Y" gEKȒ~\̾UWir^j\@e[ <=;ogA07Ð Oy3 ˠ;1Wd7Q5aܼSD" jF[# y2&hIcr +'P,|魝AXae&j94̍/0 /E3!FAsyfA䶕c@~)&-O=wm)"7b'܀3oKh9L\%x.I\&]?aGQ$BSyO0j )|شe\j՞lvP[Ț~cȱ'ݿrR.粈靪$c@I>h ^Nʿ)Z%u iO9VP" 6-U#|0n7RZ8Oo-bA1μ#V^b hb07ԅ ϛEBh 'FǷ6ETu?YK`\)+gFtޞ4 >oQ ~`!B'z m3I<-4M˚(ٿ,ĹAdT.Zm j$VXu9s'X)0w*{R#~!/)%j}"ZaGkhX-l|HOx݌U^6Jv`S ԕW ol-HA0L Ro /w~q>~ZY;?;?Rb˄`|xU)>c{yIsk"M֡Ȥ gSxW|bZeizF+uGNDd$AYwvGՒ,u`D:?oy>415nxXۚƲ&6/*0#d$ViMu`L/7 l/׌^5j c ;ȅnp\u5n{[Οjz.ߒx#jn&^9/ZX;Om/7׺`3 I.{FU__z[Wls3IOkJA> 8v[kfԡ(˩z2S 5(YaT- hg@:ϊG0 75sT ԰R5&yAE֨FE* f6x'TGs1X=BXOFh!#5CӮ~l8BM,PC)Vj' }TX\oH N`!ptuy>X%¹Uf#`%!S=|Q͚qhqԠKduD"Ǡz*+oP(}guus~sTw!J(Ԋ#!\[d%8)[={jԸ3IK9ؐYC t+=7u nI_dgV}n:,E"lC Bo5=^^ߝL>Ri7S d+E*uaZ -ɻc!Ǿb%ߠ%֡fQ%M]((=XUU4,΢$7d]6H #]bPM(1†.\E@3d> /ExtGState << /GS1 12 0 R >> >> endobj 581 0 obj << /Length 5202 /Filter /FlateDecode >> stream HWђ۶U dQg^[ӹU i2_{IJqEinr< ` o#6e9<[0zGmB#NOr>~Ru*]WBv(WtJQ>;^F#JOʈPzn|؝59w7eΟP)ٴbFT6Gyr\^>nd,wFZu^+p=n&Z2}ɟvߛrf1gtwVt,dD(m(ս8(TS%`Q+kZj{ ؏r!׌  &~?:Ռ)%d%c:oFKXe&TfB6l#`UTn֣C~3' =eSj&Fb!!'=&@r/_^{ dXk "nz`ʂ<ʲ?dgǹW4Ɛ>`\qsl7"ˑ J=&;`e~ބHA)o K7l}oac3EГ?PGwg ksGRWn$Q$z,fs.= 4tAڠs氘՝sCq̴O$ `Lu 5U.3u:Mzci̝;8f$Aʃ17k6; bt3"^;reAd*&YVan@STCǶуiEf:DH(OU ķP5)UΑga[ųFYټUaj=]j9{?G9|NSNO%yP{BzD-A-9eSI8Qk2(  crRu>#|F~}oc#OFPnP+D~^.i7$D\UPuw)gl8xtWJ (u8I_5*TZ"ōHzi:$p≠Ҽ94}hSq>QJi tuWޠWPt}ZOx:(nI߯orm{AGt 45G瑁PGӰPb'bWWΖMzUҺ97VBۑ2ZԈG _kkHy&&[*%54}vnE}YtTq9hI mF+iHN3(>\%{u?6\ ]Uل DU1w?6-j鵇K.hIEwY q!r`Aqr RvZhf3wo:PFL Vv6tPSIv8\ _6 =]kGeHeN7Jo P蠔4IL^j2%;Oƀ_y.A/hn-# ,<CD4X_~UuHPٍ|HiX,סT)GB 1EPugߛ+\Ƞ"w&IV|Y}~kRGÍ CƠt'bFfUVV;B9ci{'Zk J:.`\Kn+Lfw##Zt.wa''$lH2 y,޼vOd2Tީr KZK(寐)<߼nU+PC$rAJo(B쯃8 EUc CzŹe#gpJZNBA vx  vq]أ> DS'yvrؔKbOQ1fʌ!=ވOȮJ,< fUK*>/?~xŻy>߿ ]AbmpPۏ_?O7?Z`z!rz^l18:XnO4%;]{+S?/89BFb=I$#Kr(@q9>z> wmђaE$g>yYQqG֢ˆ׸ ?uu߾VUO_ȯH E&Fq {@h=#RTw ٨p(+ݙ`]몰Tٵz4R[$ :{VugwhBda1 i8I#Qhc=uuEN%8~ڄE1[vIA:} 8;һ6.VfMo./\'d{OJ!ҦN:d ϲрb\}}pjQGɗãEy1A\{iWs2 hXќռ=0.%Rozv:⧺4cDl ?}܇^ڬd $ bz4إ)T0 $5gL?9ğ]FrWFzq`=tA ! o <$" tA5S ]&ő"?R#-qU^+ 7 =9 ,#V̈́eTKP57io9kkXċoaEߧQٵ0<>N#q$:Lk`2 g/PSF-vh''fP20{@ڪ푸'> /ExtGState << /GS1 12 0 R >> >> endobj 584 0 obj << /Length 5746 /Filter /FlateDecode >> stream HWێ~ ƁD~AY7^#yh-=[nnJ'kfdԩS?Bb!U,) Òii*/#vwmĶOV2 0ǫwLv=(}cZ`j;ٺ7\QA:Aﶢ!7!ُ,O}5 #l y#k޶5 ?hGrdzNk5Қ_ hfj#U[:_Zx,2VAe}йcQV\*qc7^S p[7Cgd쟫eU5ӥFRfjc?% 7p'G!)@6cXKpWڢ#;'iNЫf A[gY=jeG,P:YPi 5ͨȹ4H ȯ,( 4F@V;VcpQs0ag'7|ZܣyA)MMjprUU [F})KJm#U^|8cġG>;e /qr4u7;D'a/ TxZB{݂+<#YNLYe|Z Z#1&<߳2KgZ_Bz~}~fNkF15?6 ^:ZIjP$Q8S!עZ̯YQe^y5lw .Zmj0@ni؊I.* ֝^%;GUx &$D"' ɖdt9$XAhZWl][3kNe^20~'#g?Ȗrz/!Ħf9 *6K't̻eMUm աޝEӻ:-P4~M/= i*wu%<.6W;6#G ӈk&eF^hx7]z̏c W\V :@~ObW- RuOm雎NL s|w5"IJPpK)FJ,^J.e l|K)nd%ja` w)ÌD(74F\ULZa,Y)C|_j}RI=7Ed7ɎO]%1f.R澴4눝:fχA!!K"JZHz%9[P{'B{N}4ɳڵKm~%x#0J,8 F f)ё*NO\i},$iFnU@/Vlqg8LN:k]Ռd)M-'nx+@TPvIڐEL{ŀx@lE#'W2(* kh\wAt L`)JWע*M][To|PqU̥:JC+J#B+9h7!Jjz֯$ΐ ~C3Fb(dY4d, ="\rjf#|рHaU="Ϫ=qbN|W˭IHXضmD2]]\jݴC ք\;x-D omu݁{!Lۀ#WK\& qȣ㚒+^bZZlw>WDݝto+npKÚ؋0E1+A[:FV ͨܘ;K%xJjbEZFs$-{ "ݰ'e.$HdI9xW 2e]1l'KmVpHAn~|@$&?qw>|A @K$*' iHqiGrOwͬ~IjJ "z$h@-riiRKjoeR5ph&c:;p)Q}RV/g"@,pnoND8<䒬; #qK Zun_^KF/e9P{o[+0 W7 h Ib1 wloGd1aP DO ǜvptA$ȠH(J4{VLISV4B#?xAsKHRjmh(;9 #&FEj9155ϷيB\\.! b Ukiyjs]HV~Y%kN_սIsdFWi 0l0 0dTE{EГ2btOal9W@!DITH JAʧ5E!qsI*`\q2ʣXn'5`x^YX?lƉ r.tYh‰/yLnlw7C5mj3Sp>tѹyJ yx+{-JwkuD`q*eģ (`&U !SPw ٌsYgKئEw"3 [$ NV*#yF+,~L->twی0ɨB]tF[OTc (wm`VAx4 ;+@[P(&];8Jlq:r&+e$jt5F/Ŀi =6j#> /ExtGState << /GS1 12 0 R >> >> endobj 587 0 obj << /Length 5573 /Filter /FlateDecode >> stream HWے۸8RϽ"Ka&&N -~(.)DIo,>FVZ( WfuDVB뫬1P8v.\ԁF-j-̞3iYޛ;Fq;ҵEl+I-U=gPWt}l-b"Nv:᤟MYKLo2đ|,RG;.oWN3+]<ؙAT7FY`!L]xϠG ] P.o>oeZU?N-?$-qBmJfj#=-LMC4X''^gtoƹ|@ 7o]?21A$3Aād C/:nX;xYH+ ׽ Zox4k_ MnsԙW`:gyO81 S%uX1({>15т4  A$%4wQa)۪v=뵮c8"b|՝WdZ{-}/#6f!YCo(J[#=!% W`愉gq5]hn7CK؄/#q'w+C4DWr`G8gaÄ"7y .CUHM.M˞2M&`/=.)5@ӭk1tdqwb#dWLZ)`mx<PUQiLxG6^4 )| E:a)L+M|duS5@{pPMJGVIl@ [uOM/ c` b `%j$_]P)aɈ]KyL=_OSÌH A%GVfZ6̼82;K&|{~IJ}; 6dgބҦVxIM_ߑ\oJpZ79ZS_#~4P_!ô:'`QDŕsmS*DвiY梇,)Oey~Xe&nc ϽvrV& Pq䑴2 _t*Ru`lY1NczӕDI9M"W@F1ֶB[VuE;eeK{g*9O(~8BIr#OSQ{S-Xg!->&.Iv6֛Mg?PlrTf8wݺ(3&xGvBz4 hR`sԗ[z($Wip H-z_4? RsyYŸ1 z MaғZ~e Ɠ0g5q<ҎQGs6T~dBF!4n$Vu 磆 PW3׺ Q-(@{p}))IRE[6h I,XE<͗@^D H7<<牗S9>&ܜWW?}x; rC>Rcφ 2Ҩ`;~.*QʈSY<"h YVB-C&#nNަ˳<>2B#'y$ ˥(![cM7b,S!dz93!n=q^Ao@KmԚYɎ :@AjswFÝ /Ѳd*H6lebM<=Ӥ4+8>&_rS|#@Sĥt 5;Ge4pltq.k 5# bTIp=$Kqɉ>6+gyavs0 h_z$pj[Cx/2ݫhfY) #$X<[WLPc 0'g7Rƻ0lV͟-lU#VAS]"&t- d읰ֻLy4>6.W ɕ9H}p:04}5g+K*!O e endstream endobj 588 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 590 0 obj << /Length 5016 /Filter /FlateDecode >> stream HWے۸<) MJԅ]{kFN"!+(GRI7j<ȃsxy.E"L:Vx#&\l뛘L88|on(c~yvW<&WNF6keŽrJڼTH,trONhN8` ,vDz%n(K6Kz '''ڳnН9}hľoN}auUI[Deh#GjTn*:33q<g*3Q5™KXYt>y-LS_PQ.SZA@ȆNBޘBtFMQYk-~rQZi;aB)Zu>uu24`7OߗV %;2ֹ:lTT@kͮR]Je?z5$sWR5SwIYUҼ4STB_{ׅe6_qJ?5{_C!l\6ƥÙN0|Ѐfmi3˅/FvHS)o_]nKS;i~๱ߪZڣh%6zB?Ԗ^`k{+WI"asZ^ԡ3 nXSm%;/q⠹T/;Zz~q_'|=Zݙz,=RTJwV5v' (1mPlqCx|cHc]#ihl[VTKkXk.m$R _I)_],(zű;?Ǜ4Z%8 !܎Ebvc(&pzu:)ZY`P3QӈEWA/-Hf ЩY/UF_pF쀵SiE'x<+M_hʅC "UiWˉzQweE#w?pF|Qs/ŻMfA5XRSH_OkIfbrhҚDzBVCֺֹ 9Rj4GQ-sP[ 0zPNg1,aB(MAv:|Qɡ^ Bvo/ci-楖 扛FOUmu *[.t޼2޼xwo>AmOLxcm|4Z?w/o7o>>bof67nc\Dv?@{AHXαgaz,ZBΰJ i8Ϧ-㺮BɭbQ #b7$~/[mMJ,5ͻ`SSaCK@4aEXN>EE(`.mxY])eI[H̡uF" )Ȩ9PSz^-ߦTt ѕCPd70[1LV` zNcqWoh2Q& XEc&YfR9zS] y.ީ[ο;F=l0I~zpcxÕ'Я&"OO (;RZi2@?f? g{Y!i͂2RjXz@#GbʐM mx'?+qM}ఢtkB=a{'HP  ]w*2뽀Rˉ]tQ^J969(e>If0-LR3;o?'} !mKq_YCÛLF왆ؙGuۍw *]'S)%3N}`@@ G^ͮ+ib)t+&Vį\"OyA6]O ]c۩ߑHְHkٖejr H ~[.KrwW$}#&u* FO ^F5g4 ^,}9n0=(\0lZBFG$̭׿@3 טkr88T?qXU+SN 2F4(ʄCaIyȰAlOlu)wY-73?^CsằGʤ;_j+UjmTH|JF F}3ܢG N$ߕաVeޑCr_t5&bJ@s  p-vp1ƑXcbB}_yi4MW2$).ig86ҭ֡9umap"]&}o`%t41!]kh~s削F§+aQڤbFa2^f#W~C] @"/jmXiL7XSbyA.7yHZN0kKbqcV)G z-xZu4Pdد>ЖfD#蚊)цH5s}գ2xJ!'*j;)N!ftq!*~bLޖRݔ)\sB^V@V1npx ']n/(NVNMώw*G><>>(<Jz˗T"Oj{Z d#3G) E8OOnaDE(7`1s ҆/I5=dMd)ā"^U1U-6V2lS:R$z"Lӌ mHѺԦ3~O$D;^I;=eWd'y9D_Vr0S*Ašav$Odh{ JYL"XpyrgJW?vtfk@<ٷ*ݖ!KANl P(KZܚM4v$~x>X0\-ܫę#E ם!R^@S>Pnwx#nDc7M᫝W0^:=C9 YYau6gxQL]7g&{0.aycwիV-b7rf]yHp_fG0sȉ㑶R2u?X n4eي Y160 q[~ }]ُ2b#+@X]+ vO45`9#Pe_N?DVm )QS* ui*X N'PbnTAb+'˱hbRKxK9FS̙3BZla虰`oPX'}ty"T4MݜwBkDPXlcqȨ/C;&ӻ;š"@|'b ,CK lGaK=ݍ#}kC׊5!c}6f@q]E?!ǩZt6|^fo _ N #>2pGw/aX)fW9xy1^׼zV>ё3V$cw"kE1eY3'ja}ѻ\I؁Eia"a0#}ʵi<`ֈ#s3u"s'0&\XΤ׃/<iawXwh`T1sҔ!Ib`>'hQQx8-mNr/u-/SM3gYRsJ)0ceߵV;Sn0vOw~x5 9 0HWx`G@w[}6vPf=%Zʶ5RDjj,@ZuL> # DKf.U(7q SoviBL,W)b+4hshq u#]%OG*"}enc``0;0ؾH~o[A?'mRwͮgvXMA%@9-^x<~pb riqLaNT ˢ\@Dz&-mCMM=KT 1d'Е%BktE~gZϛ3 Gc M8p.(??dj9p,,O WK,?NVX\v/dB U{@;@\H_i",FTV^ߪK iݰ-a \XK6] ]9h*}$x@JgVߢC)oӍ<;Ђ^,l\x"s=[N~$5=qq *smcF :W S%~\`РCUߣ~O";ՍAcyˢl?b賋 A"5°{\-=5*E{S2=*yS: O5h(&sVͮ`D6+Q|hn۷NJN u-5=ik}Y?6Za8:uy n\&%dg){ ??M2'@&{iWk:)OX08~z*/ uSyq/_|o`0Ԫ endstream endobj 591 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 593 0 obj << /Length 2250 /Filter /FlateDecode >> stream HWn}^} i]Ps81"EJژܥЧ*Z}:K*ܯEȝٙsΜy#\ȁ1bEaסZW+>YWvE뗫 q=4GoDǞH1 ^\^Me(" Dw,xQIZՅ}?(v B3c~)3فR1^NFKH!j.#2)<$UHlCJu9D!;.~W)աPo-%J,XӤ=qpC64F j@oDXľ f VIbRb<2Ώ9N &~X<\"VIU"v(lrKCReM-y vex;Moujn(<↏u~-m-^{V}Xƍ(e }@GNg]0,J$)7l5qD㸩QWz6) aߧzhxgbɪ. ]+/7%s])T(5L/萔賂B4u7tp;J8t]ZѸ6)f1×)8S()39b/Erpݲ4J;'<FbE ,:\(EUĩW>+-崥 пLm"gOirWb/ZdMqlXdq@`FT1 ȸr;%fz,Xr ʼnܣ B@ɏ6/5 ^<nG2ߗ&&z HMB哨AK?b}A.kD@Q?-DK䍁=HmRr;D;A/paT:@hWu$ZRisp;3aeRj-+ _><\d%9Y`Ecџk]w8)g'we3'E~˟l(Iy& L~\ N* 9@Z' Oݞ5||=L 0Ojg˚ÉbO'Q̼̀0p8ϔZAG]V,?Do`Sw3zf>Pi%77ܚyP7ߋ*b>y;%f0xfP:L`Kh(㵆V3`\ee]Aq uڑ= ԨF\"zLvXif..j{lpD؝螙KYEGn“ 0HGa>i^HZ<(;ZM xΡSf{pg[TbojؕVkT>QH)/b3% %|K (j OH0;6) D>zݠ8E~?#a:)sɟ{h49d@ԝQ]wi0;%JwR[| cd.vOF[Foa Ȍ~kX%Vf3MY\'1ZOD aMn>k^C[δu-[EGf߈hM%3|KZ_߈^բokaa_ 3\k&<<'񲁶Ѓ#, (;QBށ1> 'q 0ǜs^f;ީcHxݿ&_QNky~2D~ZK^Z4NtQ KZRjh "}PWvyԯ 3twT"݁i"AAw0Fv ڝ<4H]4 LQ KgOwU@Z$HMCxJ")޴ Ыh3*,[cJNE9 t`;:V[ԃ tg}ₔ|3S̠0BX/fhI*m˂HpAt//N;G8Qjs2Zw\ô/f`Ɗk۷,/Eܴ(Dah RHxNQGaI#:}hjij(!Ir^|Ez:8l0aSS ﶧ^PA\ʯ[>QO/3Q',.v(MgL :6 H6oPF"~? j endstream endobj 594 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 596 0 obj << /Length 4988 /Filter /FlateDecode >> stream HWvC/sH o̬d٣D},:hMI"4 |Nn-O&9^oݺu9g-V9/g!(/-yw7Eg%P8߆QbnWh Yհk~+[Aj)bCb/I͹~`bי,g Cw r7ǡ6Փlu \ 0pxʵB~$>{lժ-6Tz򴓤']h1)WS (/,4۫VoN*y6t;M0A4=ȵQL5FUv[jl0{q`bZtRcNoG͟:چY6c; [3(iH2?)ly q=HzTjXՔes̶{j b[%A(׊B1?pRh!Ze5v{ʖ~Tw0 ^Y1(ͤFuHԗ*n8hЧ)꾤HG VҕTL|J$WTO@{hUEdtEX"g惷]a)6#ކ[6Q8t% s i+06 x` S0r Z'khuɒuSc*g I4n7Q&]Iɘ8I32XH?cy#2ce+:jђxnӨvʺ0R6".!DJÅNLc>&hA"3WY<\`SP9t(@зȖeYvaG.I&ԷxzO*j.sVl䶫B/.ҪNȦgL8s8>@qaإEu(P|6~:l5:)ǠAxY/`S,?fo?\ݲ7w}X\~҂F Ck^7o뿽~{ȋy`v Yfk`1Hvj g6h;ti؝蘱~d%54e;#=2p2TfO0 b8J>}{m% ϭR[s*vHsJ?f}L9֠hk)?f9+6CZUNȍUݩKCǑM+dx${OE^X|`ʓ a4َ.}.]I4ڴ;G5wT[f=9Pݿ76xy 9rTf30Όuq/3SN*vMKO$|PӄZZNI*oF6i}xF0ߛ;=5vAF=L]tÁvnށ!"-Lr3caFY}B" 7}M}]ҙ/g0"-?!zz- ońu{o34z2oy;gr$Jlɲ%or-Vvҍs?VQ0&T-JD3cs{xC,Fsnsrv࿙XC -@XJw/TCUD4qR $(e{VB#@,3_5A_rSd%q?ӥR iCmًeK?1rUg{J8^<"ڃ03Sijcr([rpr-ce{Mn P:tnèQ*-*rT{ݑȴM%e[](fg?L<0w-7R:͉iQ8 k8w>p " `'RPnʉΎ훺JgFz~bP(޲JfTׂ%˛nRah gĉ$ ^6|)gMi#>{mhg|˞OIeaGRE3 w1%HT[s349 ^KwP; | 3ͻ8ڗ(0Nul{a rzYMAOe95byrm>%1.=eM/Z ðlւ ~23HE'n``o 90e}͉3 6rxZaM~NWoKܚܑSWNx] g0e_Æ;f^85K佛-R9{aYB7E~6UGb[rT/#[ڿM9T/>xu7Q\0A¤ixr[1z7TzdӎR#r /$y!330^ENE2@r󲑰a u/e}j V^!x`3l/*{?7f2x{ʈ\F*0'l.jJ٠`i)$:IHWMGI`gW xarg%(nִl䠊 r &OU_ ի:iP඄e<+3M(OyYҥdg`{|3jWn{tßonǣ7]HA|3w~>(8Vt7ն_Ȟ endstream endobj 597 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 599 0 obj << /Length 5271 /Filter /FlateDecode >> stream HW˒ܸ#G7co oM!E8 gVCWPWo`>,.$"Źan[xCN-ˋ J+3] ,ř7/n^?zQF`)qYw:Z~Fꍬkd~d\ԅއ^9^+n^Fj!4 u@ʹ(U[' kUjixx/8Hsfu)zx~j $\hG|!OgD)B'zZ z^;& ;s8F}I2QfCWB<ӛ" ,EU806 WHHS^tá h‚?ϸ zhz%>ڳ)ePQd{iU#(A=gVImd[y/X9ugC-G}(ۿu5ߍE]nG07elh'|2NNjU϶y9< -OACz@NHAaݔ",`*, ӜX6{EZϖ)K͎ l@/={bSU!^D mLA+R} J F ݊p +,jqXz[ p g QC;^>0QqK#{S#0hƹqH7לS%fõpAV ݱ\T E(зzwStQxBn BWMY䜥̳0.9tVUGj g9nZjyf࣫P1cQjDs׵ c>p?46`˧~z/>D>Ƽ8%YYm}HTv~$fδc(`u蓯y"v^6d)[ল*2I.X`^W)8UXT۞GF%K?do ;s.-yFt,reŒQw  n5 ٯuYs^X2,vysL%\Nu%xVf2>h&"OSO&tTV6!ҺrZ~g@li 14Iyo_Co@~2aN[=,~ Hց3o1Ԋ !6CQ=w#H9[Bjm_ar=!4,PvU"+ZbTo-/Ot|J~O_|_LdR`}NʚF;_n*2[5πK&C|cĸiWrWл[츍يx4vi΢vg/j3eyOH5L<0q<ߓWAïdѸ$-_1>_&EN<g@~u ݺpqs@?\;lv+MlDy!+ fYn4+n4g8x^g., `\ 2Mufv0)/rµi ޑU|L_Ae-!qxxd)SrT C[;Bq;_Om| ߁I*7bLk5Kgθp7樂q'w7Ŀd^Iʙ?Mʅw#rAE=!pDk`AƏFlZ~д:25z QgǏ: i@oeK}ZY'3srXe3bV|>ˎ Ac,@4J/؆R=M˲^`2 *;Q^=mًX(;13z;ZL/)@"x7@O)Y$H[2>M[㰙 !]458R2%oZUV}ެwG{̲ Ѭ*y{jyrz|g9sG.k׏֫Z={t-bb廾-PK Z/j + ]$g1( 0}gs{[8X,lmLq; 0ÙhNW>]<5vk-9UYޛ)d̸]GT:@wue |c|%(M ԏc-}\$%1}|ޝe]H/5q*k #lA"-9E찫mudL~''d'N-,I:ǖP20&wM4x_!UW*hJߞ7uom%+^7jp^_n^Ba05{lfFbbX"B"!{taݞ\o75v¾gMیE<* g5<2"3MG2ף̡V%\:x$oԂeݸ zYOB)cAq}HP4IJjq!ZjxôP( +@|q(1-*`w/.NԽ']Tm$e>6)2H]<38pN"!"‘zUqnN6WɠǺ<QlMJ ~ajwL:lfsTK"!鋜E937"ϤF9\5/pe9mfP}zc aW t-G#.Pfzd['sjNלh< Ixےloo|F/eێ"xO?(:nTie0Y[,pT5:ۮli]7( TΚ `I=U0BV܌kL7l3xG"WiɆgZ-6كq:d~+,~o }t rS$4f #|чKJj|//Hlx(9=T:Af; A3\dG>):U] P䎞76Aݤ:mvS $f_JZl<;pΤʔ@sR& N8\ @g0t u -J6]`2!ÊԚ}!] ÔX%wSJЍuTF۞nAvFBƾ|&o.3-U[]$9Uǐ<йY/X/Mn}0T,xX~Xn94뀞z'01Ɖ;dTs[ +KX͉ 裑|ALD0 9IZX|MD$n!iKU 2N@f˫Em-3IY&kUM>?؉0tO6/*S' D<3XZ wjLqMEKBd+F`0+c FE, \f^]/1~ 8|t 8 N'm(5gQ{,4DF;L7톽RBW$640P, zq8w}9f(#uL!t/\3 uݽE۾&FN&? FN},uz'!Ǫ-hP M' V hLͭEM\Kh188p75P;%GadkaXlE(rVE51;[Q$  D-B]P'"Jf\VػxrQ{!$it endstream endobj 600 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 602 0 obj << /Length 5705 /Filter /FlateDecode >> stream HWRJ}alaE\-)$ 1XA|gd|yݭ>{zF%[M4=ݧO8yѱ듄0/rеce[tɻ˹,V'#۲m'+XVBBPՆݟ~)somt8ŧ Hc+uU ^e[J\UdmKYYO' Ƨa# }V*8"e#c/O<j7³WDJYs(N0)2{xҫMWB{BdwmM=xmb_9gk)Ԇ-y1%3O qX, ѩ4vM} Lmz-뮵MY;Xg߿`3A6٪,p{:h2;0zOȟRT\D`ְq@ĮvJ񊒭x2^1N~ѻ2+jJdݯZ/y%M\h:0?l%MԾ8u yZ1lEv*\.R7\,ulm=ǑybݠMDAeC+7DR9'3A;akPijȖnDm.8Ϗؾ!3>ct-m?Q p~?[.n 8~=G/1^Y^LAy1 +%I:/̲Pf _ǷɅ.gE@Ab*i2&42XjG:;^7s~z3O~( Was'K5gw:`ؾXAasRv 2 Cc^Ptbp})QTB%nT?1Zm3[w%Nl>Ϯ.&}4Ȁl/UX^qw{KFlh[-b9O~Gc%˾j32=m1kGN!g4]uHdHæc*Msi4RP}k*$ Z3vY.*P\>sEMJPNW8آ1G>Ğp65mٺX`8l!3y2?&{zNzOV67clz^)+fn5H2oӻ_|*(³c~sxʶ;dX.1٢4aY.˴'&rB{ډ_cZʶ2MᢗаZB{@r_F'@.Ϫ*bZ3Ktje,SIH@v~}2a8Wݎ[/enӍRy >YqhGk =V{Dv l6 z?¦mYvx(sH@h}e_`lZ)#Hj Tg\j/q Qb :5x{E؊XAОXgyJ#hX&י$$"FRCh{]k!@Rȣ *8륓.,;j@n/heΙ_he)7`&qb < bHQk 4\GD#6 6&{j͠S&qHx$ٗA%ޮ kNlBz6mgQQEL(P1~}H:-ˢ7ۂ7=uk/`|y)2;Op%=prph6QG? Ƨa'5{{ [NW*TjX5:<`qc|G@va0)EͿ\LL1lxWw#;Z~2ARG><53BH?}A6#O0I0yw9 T{"7Ƚd??u̗D ,Vmʩyrq/U ?& .쫡!~nO,,1͡6Xau?C`+¿G_9K!+U(up{~ROW^UsG? 6$e%ƞGD-c mO&4UIk0KPAB v $C#l^XAEZj)i p4 @)eڊ<th.$"BZ $.mw4sd> /ExtGState << /GS1 12 0 R >> >> endobj 605 0 obj << /Length 5281 /Filter /FlateDecode >> stream HWے۸S h>CK2WVg93 \ (vQ^t7Up]Oémaj=*@_f"({rQ93:[^bN,~숗 a5ƞT65 qd178 ʼ(nT$,㹥sX{lLeN< 0\KWLO"`]wy`g1CcڏHv`hQOz^)EUGYLѯu$_,$POfpY~%J2_eF~J~4RNB4:bwaX/з?fiTI(Z -YՖqWMJלA`(:iڣELŠ\aU悁ԡVŤU =*fpI otr:D`қG#m JRC:Ⱥj4b#}#[ pg(&6f8BP75\N@3 JFJBAj6y340ςi~^\;'R+ !ΐ!B}aߑtQ1Go#`=v^[pF/љztc7~6BMdF~6{v'̽ Ǥ{ R#^wr '(^٘F0-~܏f[BBn2Cgj,M'1W5=vB;LDԳRGhïqDwL'iiJftp+r$i ^IBL1dBVE`Ӕռ]3< CFՒw4Am͡]bϯ\,dygnmftT/ȳd6;WZeok h6, 7=-s#3Jћ DkK#Eqͨ@UuivdreyU .P%GE8zIRcGڰOݡ<Ǹp  rJjUkL!OLa;+~_>pl ZkۑJG8p,w- 14fi7)6C+r0J?LCBJ {ynp 7П+Nv]0B/0l^'ݴNV6=G/ iʤu>\/Id` +@nSkpZ: ݭwvG Et x\FZ%Fzd*NIwK vsiUr!eG,ܩT>KwRZdh4.1 m ϸ8;7۩kAEt`60YLnzTdg#suaJ K? {A:PV tAcDd }i; i|fUUa7o_;[vݼ`l~: p<̦l[u U-jT5䵣.`!s 8pS푽PoNh qzKt)-q= 0wgp*2|4/eJFp$ `nB1q41PE$,-,a/3m;UY/29m>]Dgij1xω |Kb d$IxSȽ%Vʕɛ#`p 4ga/0]dy Kh`nQ;kˠk`óc=KB i6,3PMP4+"jze7a=Kedo(ف+ƻ{ަ?B@&_J=n⑮ .pCv=EOqe'vF~.s[d D;b+sI7ǒ .~-Q5CGe]#N"=t 2-Q%oP芀Qa:6L_md qM9vꊕqAu!-᷼Sv ӓK#|tԢ8I~yCj1@o ֞Okb#ҾQ18~Mf[o0fe1 ǣgkX1嗇;s':pU1B@{ :`HhV8xCc fő {A8V2{X=t?$sL.?L zs!>FI[2㭩,`t&D;>X)vщTuK` C&RoILj`ێXi 6'?- 8 $Zvhi 2Lw\-?> ևv=9b >c _D?'Z f>١v71K3Ë/-c25 wdUd,J}Hr@z_"|ȫ_DIinzūO/r>.ǘpȪ6M$9"7 YQoM8nݓa=x.]tO"4d4#+KLl ڂ0Ҭ"3#vw8DrV~TTUwfr&aN+N݊+Djĭ 89"#m7C&$ zl^M0v}fCxB 'qGr endstream endobj 606 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 608 0 obj << /Length 4875 /Filter /FlateDecode >> stream HWrCl"a\[^R,XKFea ID d_!3+e[AO_N>nqGYJ.ĞnB,qYb{/=z:{ޣu'l:y,L6TTtʚd#Em# 7fO37{dz,ޟ%/H́|? ]'”zI( ͢,UU ˢܪTM8nd?h[eCKh-[wlw]mô ijIע@+Z8b]TqFEOM+Z4a/ t}]"{̩[y.ooKh;3<7 {Zu5.I~ߕFVTŮ+щhVbfYQ'-5SƏLMS S_5oEze]|3T7kS˰m-=b&m+9 x\%g %/E.\|H*Ue ,V,K.bh6W3>/5љ+a\D߾:EOR23ڣ'kЂC߈V#ыPc6Jo>WފrBOipRlmCdykYC4r4a4gYk~|')Z| o6ȼ+ ߶}D)au~]]dK3: ٢* T!m}n#^$$Բ,֦ϔR- `P84Ё8kLNO&j0z({;@pC9΢$+rS=}&F͒QA#VYN6b۳sƨ.k}-p)wkYé}` &/M]"K{Y+̤3fPїZ6EO(Xb]Ki~8qUKUۂ.dⅳ쓽VtSKY#ʏSOz'P\01U!վ[ՙxja@iEueΣl]<#^:ʀA d\8Uq ʴ!O4hڑe~/K׵zA Ц\n9HR%AA8|&5v1?1Hdo!%qַoh񼑒/X@/`(\h"3J\Ք]48~y7CqEa΀̟7; ^o|X"Qk$$ar,ᵟV>b)Z9.?k-VĚoj&,5;?V<[ED65jYá elEѪɡ Ui#uBw]bǙ/(\e:J^ zO ]l7 fA[z^>^\Nn|7 ŗrDϗoY(DxEPRkn7Zخv ^`5] OG ط`!y@ib/dv{YkL˞v9ix|3aQKIf~S;N&#T`#1MLvi 3}PZOf`z,Jf4kw:2x^?cOw?nn[\}<'ĦW/}zIo += ]N705),ad鄆·Oމ~} 8|OGO'H0g=M~5WC<nN9ŜHxH\I|UAO?xjYn_E*Ռ8l$ I&Фz  Jf2I̹6^rW}-ȲG v[M# b7!(aܩuH3B~7<, RA8X-眍(!e$'m9cXA`lQ7W:Dfw JrSU7;69-Mj3ndtH3^pFw,7tQ,$9Y>ipME>MQB2$(ٖC钠I2D)z dҥ>Kb h oCVg-R]n2{ħQL29r EqLŎ%9GvtZh(״GB\'w2_l^W3p"% AY?VN2. x ؙf@e]Z_zokgG@%0"״c+XfGo3Wo.)'46ty `M\}I%-ǮGvGcۼj[`LXd>dJp@@,;ݸPHe\\Uqv@چ>򩷎!aOT3GR AsϽNq-L_zsLvL'+~܉{[qkv}sB= çW\+Ry?1Mq-kL'L O% wakAb UeM;[9vń[NYsāxS$qM6DR0eƟ:4?s8L&ZgaN!ߑ&R/ݧ+τR]UNcO_'ѥd%I?p p;Ѐ3x›!7߲loyѹ≜ ?!sn (PBc|"3Һ'8s7FO;~O6tpbDZ`BO[ TX視9h;XAej\`: xuS3]%}ewt$J&iPnP>Z8x$nL'^Dw3&2 kU(W]~I6ˉk̃OdrT+˥uÿ$X}zJKTsfaI l貭/5JA* ƣG27үRBvx|[*285ML}o>D˩$<ƂP5x-,RZwH3V_zN+'\Lydэ:3Yդ?6C@'LF?7Sl:wh{;2Y9vQC?h[j"i["c. ƻGf;r9ZmWƈ}t_Zz Jx`t'Mo%Mł 9P+F+Aȋt<%]%ckֹ؋7K߱I#D43UEfyЋ"] ZỶthCDB.]#J,^?1ȡ˰(E-)3;n HߛL.(REkyaر ;РrAM6s !O;: bŇR `R endstream endobj 609 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 612 0 obj << /Length 5498 /Filter /FlateDecode >> stream HWْC?J)F,Γ#U\JE+'䮡˫Id,v(-g޿z=INe30<0n9 C7y'F=ݠ:d>' vLo(+m?ڛalP$+ЗϚIEw`]NiGct9%"c8Ή靆a x5޹wY3_)֜X_wԂy3kv^M}Ogμi(4C5OC*X@j99 4 ?rQިId=layF%B)hG=L;S.e₝.R7h\#"O:z  Wci='ʖ hF+<E -@_&y5bpF;l?N5ܕE{՞eN=r $^w8 '¸D~%!K +gk" [?%l٢q鶬~\5X gz:16@9)! rTEq]6&HsumHgq覭D V)wy;vWyF' D-͉+lfV,'j\v@ZgS8 1ϣ008E eQ:\R]MnY9ָ.fhm(ݣ߱ {4u5-Pչ_`am^R& "aXXhe`m)62MjB3ՒG NӶv`o3zW}x$ܤ s!̗ɊFCGK*q0F@ 0#,lTS\zXY1p1 cR4Uz8 *]PΕos.ZZy^ll4zSH'{b+aM6y>OXR^8 W/O& FǷ#TEU^!X6D{;-w2yCK狝r%rr _RU_AXEG~MQ]:<߭2wGZC Ngpv3Q昆$!E_c}ƛ_&0/gj).CZo7vhډjBGWYiPZ6=h]8 ![cL PvO;cQ4A]镴rETgiA`2yЇ%O~q(_ۯ,Sc %ـ5*U[/V3ynazL~,0*xkY(1q6FTYzMЛp.U/!"b-c"Pԭ…$ W)bPn֤QnҖ}MZҬjl@50 {vxdׯM3)7l1-Qf9D33lei;I|5ݎV/.drќR^/X2zme ցNaU%_\@zh3̨dcW۲.K`Cî JKBEv,iZՂwe4ka B-r@PN߁I4;Oj C^wOp+ u!w٘Koe/V\ :G vW35$:fd9j]JeilKv.߂SHv?ؖr@gUk0vx膎}LJHa Z=)Ղn_Os.;ݦ b7e%҉xnm {ȳ~#A'zQ_l[n`;2ۑ{75 "u01FAN8`ePpCmIW9\ЊL,sr\f =]z>c#QTdÄcJ]˚aWRKcq$TXm։|FJҜɹq| xC׳$9rǶ,H0`N"A͛fuvzS %`'V8GԗM]YfYӌ5М:i!}xooFuq؆X&'ى纠y^6D=/YD^]䂽K*s^~IoNF* Q.>٥X„ %DIjj*h9VmVZֽQڭg*VŠ;~_e*0@]I'MNqh?M;h9k* I>Dא^Z0|\;ɏz]Iݪ>͆Nk=$)%K%"Шl>)F []-WpT,vgNCc0:]S e|+?n'Q-cuo G*:UO/󯄀m.[KWx\^MkC:KeU DV$頋^浴Um4fKN!5ĤDHJF(m!bK=0mKM |oa.@zA'q:ˆ:A=G=2{AgO3[ohwˡDhTPZĻee> Fm+"ƙ$eo!?b- \3NmdyϢ19rclGȌ:^Fa  {Ʋ- ^I%']%?ab;ㆼ,n v>c7E;'G Wk[5.ZZrg 0L7dB1sGO^(,@woy9:SND5e*3yoر15TFH g=G|%iD }8R$xplxVJ=LIJPR=łW}Gx0w,$[Мڔ?"y r!9v_074ȲSoSHC.9|@Vdy#tN:aJ)00L- X_C^k<]碪 N|0S`mPKW,'\g{Cu⒖'HW'~lм(%ў(}rqB=?vH_9rm, R"]4!5FKg6ƜM-@a!Yy= gJ6u% 3 X g! >-ăRyDP3ܯVSY0Ć@LTJY'7Vl/jo-L"y%`xݷ_Chp'#/@ڡ1}$u"tjTSHCa_DK<\*r!A {},ܖ 6ZS<&Ʌ)Rf0AW7cL&okb[<>z`FLڔHl`Ƥh dl>O ^+^m[=oV* F 0pffgEGi28{zMU .)+`Xv[sqDx[i9_J@¬L7O^)l}dP\&s%'V< endstream endobj 613 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 615 0 obj << /Length 3594 /Filter /FlateDecode >> stream HWRa?"FݺIp`j*C#7v|:3e#YP%w{}<;8.P%_^DI"?&1,\k LҽK\{G<+(J>LkZ aP($F$4όaf 3Q:0F;0!))ŧ>Wi_8iXrXˮi߼~8 ʕ'F4«@=Qx%+LO Mg w*7Ľx0=߳R]h>n7&Iiiͽik[ƥ?o2ǴD.DV˲ oh\w.Ku+QB;Iϥҕ;K,bZ{'s2 w!\u5݈Rb&ಾUcH<6>b2wx5x[9p/85gR ki^ -!~{[ۤ܉x*_1^ļ/"֪ d.)䅚[6k007YDrabR돨 \<ȪrL 2t סud3O;w*LøHl~a{\g} cw6F!|5PgBu$B s(ZnR/4"L;[muZ"FZś)5D8{.ڦ0exRuSp_נNt (k9l>N?ʬ+bV:w&$'bV/* UU<<8xDe RgA/jlO7Xs 3zc[86cz@w5rſs p]VV_*?ldtn>=[lm٤6#L2GCٱ|^zBS8#c2sZx9ǎC$Y8TT"3ŧA4c$ >#DC {|$0k<$/f3d^-TfnG6=A"rJX؂tt (<81|tWD8?b[.>7d[uF" BŽBx$\jDݺ8pYeUyuŕ (7j[=dƗz)Nhf;TtL+Arz [lF`78Pu g`q;8jdQ8P'Ÿ/uF9PE5"j[#zXjWrzͻy~%I "=V,\cd3My&!qqkɧ+>vk`S$T]7QOܚ~=;PZϴkKB$4daS/tK%*q *Є"?yVh_ bY>c4 wqZ/J d:BUC$;օI*"idxzw'J6D4pz8l~ 1oW`/ma[}4XB\ժ[8%_An܊$d C{0M!"nח,LLgtrI6Znzj˂d S4 ;w_£G[x 1WJWoF:;e'^jqr)һߵ^~}m퀶V^xonInӑicc6(ݦ8<`I) qJsx bEqan mP3{kkeƅm=Å2kvw Eԙv \U7>rB]V{%;m0 E%m>ޒ$h\㼘BT2DkNGm%HVN-CM~瓙<.4|}ZsPqzϋ(P[r$ʇpR2yA^ e&Gޒt| ϤPFv"w'գc9UVE$X@=dK^T st, _ģ'j-n&6Q3x\Lz']+9& M" 78%|cqpQi-CjeK 7[9%0:aS(IX^η+T&Ε)e/$,+q,ЫcKؼY |UxGX:\P\5{ .Zo/P3/Q. yJp.Qoe^˲raJYSD{o|4E`}(0ӣN>Y#h<,g:<]%c*5b')}/x*J oeQ O0ҋX$Ε:gNԹ-I0rq-獦1`&>MVw-c9 `[XO}Mm aQw= c+:lcTDB9QU}U hGG ゞ?[yp\%P֩q<ɕ3 \O] 3 N~eI*Rur{955ďH#v:_98׎qQƤa)I~UE(U Y2lQ _j[&Bv?1D"!?VEdƋb_jSp\Vh>#7j[jVpqJ5tZV]a>{9YԜ,0hN~3'F\dIukws2fm<,LnD:աU^(^~Sj[Vw$NTZ:vP1CF`6E_,._iYL$Fc?u̾)lDΓ6YRB5#s[ɥLA~<@o~V[*O6}&uӆ=~ᄤ)-sh8Ok; < Wsỗ2{3 ĉY> /ExtGState << /GS1 12 0 R >> >> endobj 618 0 obj << /Length 4756 /Filter /FlateDecode >> stream HW۲(H7@dr\,ɵ, ('= d,0;ޯwO_"!"Γ LBqFڧEW߾>AUx< pQqzzZ7)>]%Px;;҈Nhdf+Qa1뜿I7@$JGyDK7YY"q$Ep1(@ˣ{[Aק;(j]wW;ȖK{R]y=!r&hl+ORVVqM':":Kcpf]$P+*xB.7}ݛoވW_.iYda,ObG zDA\e K7:tHwA$-Ewqߨbsĩ#%Σf(/OTz9E`~_$WQ{iF}rEP X';4V4&7/_#R5j<5׎n\iq+|cq;uO?Zq^rUЛGvn7hi5Y!j^_e42`]L]ȲiA-ڲວVRD0Cy/Q)X^NZy>bzo`dCOoا?Qsy~7[)T'rFuU5”J0he7͝7n-:$"kU .^^U-gʓm*?:z^=2 ye)˕Z&׫P 8겱tD-!Y|ޒM> ,\=P%k uBG x,ZRh ޺< ӗä%lY }$ 9Qdn >iYDgŻ],Ȓ.|Vׯ^({bI3}: lgYfd[a?ͱngA%ʿo s_ H]} \;8t3y~hZmyYKiQ^T^l+ؿ%EJ+ǶvggΜ 'o_RfCҼ"m؉KRQh41qTdry5g3Dn^JH*50sd}Ȳ8xO;;>> P\<,B|bܫ â_DmA_87MCx(.JϿ:(챣]7x&g7i~f7b_S6*MigA^TKz{Ob5lxEa}-I֭<{@K bη/HWtK00cq‰)t0{:b6dbIpfO:t ۵! "ϿA~n(Ѻ+=uRrTY]B׽P%sAzbs<@g -"H {I٫# ~&]I@UTΏL&Ŋ5F/h oPꏠ|T꾵/Jx:/RTώ5L+y+; dB=\z 8jb)ar_l3 źiԉ@#p4ZȚ:dh9`z\३_aAJ֚U)iܿ1qd,N,HHhDmՒb 1 wŤ"1X"%nhpbyӴ ov<ۍN{1| NElvd]7Ӊ>_#BrbYlm2#4o1'sD51<ԖsE-EQ(Ԍڠ⪛Et"5Ff\4`AйBYq9kz`^z49a cwQE$Š!,pL 9q)=\x5][0u!'~u.+aˌN nh/^ý8~}B" xPR Nb:-$HD}jВ+`R/ n`~ɬ5,o zGe2]': M$Yi[U=8 Re֩ߘbw,В X:R$A 7J c{ zvU8I3^6U=hρnB/ Lڊ_OTڻ#b DJ2[@ BۓE.የ8˔k5l`.U:(ZUQ(1U); Mn_$E,2駡 n{걊ut,zΘp\ ,qp3=[[==c)M̱VVJ-bTWrK ԪKCCP".J̄g:*UJ}&WoVumg0h.εTUNEv Qh' iA5Wf\oʇv"A( >>>#TKR >m++i2n-LXYh>WǞd)6dZLRSNj ޾Ώ[,h&-5Oq_ߴZ^x/w^vz,XzcXBΰ[FceN$}> Zo{ěympdVS 'NSpS~1ՋtW>m"jpǻ4m>Ai}#G*TAIͮ/YA%j9,Ϻ8 ޔ죤LC sv4~ QADk=sG\AC#<Ȅ/rF5jEqzY\* ŧ-C`9wrr؉Y1qN8sFiZI>wkԕ ]Way˟ endstream endobj 619 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 621 0 obj << /Length 4225 /Filter /FlateDecode >> stream HWے۸<) wyxekSEhR>)O]Ie5ݧO6ID"JYRDy"OMb{Db"*b-(b iaǣM;MEZMI:DYUe|lϴ̣J޼\D(-ET=_gb]<>~/zPEao>IQEUR ,6)-$ʺ{}mIQ\j9=QڙQC?Xť(}%oo$%v{we }_pw=JN➒(NpѴM$.٪z SJN)QH+aU gu:kk u .Dզ % ^YIxp8(p{zVb6N(Dr^+7dQ<aFvh47b0"Vw?Cbegw9Bufx{d*1a˼tZk=^BZ1ᖽֻ9wi;~CU CU=A![{K7:e@xL`(2ٕS0;pYY0adC%7s-D',7˜㔵zhV"\‚X6Gmyj9@ymXЁTY]L ,3 DcuGB +ùoV^ u Zr%,[aY0b{ʬ <5Ob髚d빪TV׺*%Fud L!h@hn  ?8cP7H xͅܛ:@DTG6'1.9Ʒ48, w9dW +b`H<.hmՕD*Ew V[c{kJ8Q+SZ(& {>+e T*%J=¦r5lJ7@$F y -u60!alKe[ʡlx !_^F8;PMWf2W |,{sqRj@cdK|U-aB"*4[66N #:߯3}4/YM(X%8^ywΊX ]=Ơ4ƫ޸p}MClz\E/,ǞOy1AIP3%(TzБ~=GR~ual?Ί6ўNxauGAMcKY' Yo0Is+cgj p ((@C=~M(/X3qgؗ봚CX`Ph9YΖ.G K? ,$&"YN׏@QsI 3u lzs[c8 3|Uk_Myvȷ:b<}4 ;tR "!gOt,(A`iܰJIjީƣ@e{9Qy1ֈ.i(zpT#LU؆O'LAxQ"3(r4I?.x x==Lx܎@ J *>ѻoT!W`v d&ʲWK7P+c;P@`&yx9j T4;^vyt8q t I(jaMK~ D*P*t4\:wz::Qc(kg4JqONI|XtOk4G};&xnPǃ 1ہOJ|R?mq1=Tt*{4ę[ I vY/R{ӶE0g~(SDI>&Z.`DŽPG #h`|Z:Iu?ϳt]fm 㦙 8a 4`Y*H?>JAey1XVf 3a.X0YR'H%A iN6WO,v~XGyEfipz E]hkcᆶP<\X3z3#Oaφ 0FFxE"qg -HdG :IG<=sI4_OJC\ o9Bͧu7MsJg̒''b졟A HIQP|jA)x|NX2ǟnnElg.{jصRt iq1{*0qImeH[+x~*u:؇lY@mm#~AO Ȅ )OqЦHSJ\I)+%G7 Ù324z~w|o?|N?Dd>wSmuT!}C]s7\W"Ib2.^;WRμ4Ez_lwmTZ* PLW7v$%j&P?}33N̚=(.gXxC saVV өk[7\%F0d#.T4{ƃZHـnTfyp6-$P"RA AQYY@&)|JoQ9 x hJQ1Ve0DGAܶC1'jȲu}]y xlt jrvxEQ=AG+A5oЛiιjkѽ}PZg>osKiS)fveIoD܈m䙗XDd!V56UbOZ7EdȽI`x|ϫ~WM )FUB*wd-}L~i"ȐFh܅7aoOA񍗞vS W(W N[xAI+~ujslL8nTjӰwXY:IϽb[Ȉƶ$f+s {}!}w^La|oCԴ]<z.R}":CW2>1gl[3y| F>ީ9dMO f-t)޴OFMK:e?(Z#r2i~OםH endstream endobj 622 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 624 0 obj << /Length 4758 /Filter /FlateDecode >> stream HWے6xKy9ovlU.[Y?l Pd3iHi&׸Fs~{. YȖ)XR4cHrQ–> ᅣlkɲ<-Owa  o.9ȲUGiR{O;]nlS#{]ڝdﺶk Nj,g GhJ#B^JL !j;Q63v>ʖUP^ O0#[ʞfLE0$f5[Q7bUZ3iڧ7\c۝#V7L뫛QH̃,OlWxC5kfn}N;U.3P+ZiZ׸vTNlS?}@ą4b/^QLWpzң]V6{U./.Qv˥ϔZ+M q]>ա޲Fruk"0q (1A_οFaI;EjQ1ݼʚE\5 rG+zZԥ/Ψg xZ6'./A<qٸ+%ҕۂX*'IeE4˘|D ^KQwQ?m V<թ;ukӟ1)X5qPL4y$= $ic^ddnߌ뢽AC%&.nP(FLj% lUI&'7\W[#zddRiU 4=D(ItWo%NllFZIRFC,pM 7G%OϨ  _ͰJo/#$"+H"{ kHBOAnD}fkeQtˏZJ# =}IPg#67hh[\kM^:67"I\GQ-*\3k{MJ F:+Poq =֛?p[G.Iu@ސJр;Ա-&DĦԞ<,EX|Ne]S&ͼ1e8XX.1Lֳo`H=Pv7#bK\U!2;TXoQ$N̕X69"u$x&I;-#{6ڙi`b'!ǃnh3䤻jMCc)1rYuӆf<5p>$M#y3 I&(=F5s*]#L% O%Q\w)iN<[8*Fa74؆6CQlcO]ݬ:Ža^ͫF6G74 M_$~pgJU5}8f)h -_OO`ė}^2̴7E_;AX? zccX:}ke;JȋY%θt~ Rw,K's.w["%E A6A?bqseE:ϊ;?Lx%5)Sv}fRJUzv}<]TvIF{yO)) n.KhTr xtb Kq IK`oCUt4wX'ٔp5S2mhʓE8^36y/$=>yT94n_}Q{[Wn[=ct-.rjeHs;sHoP eҢk] 5], {oNU%{B4N>$\R@ ͐=\:MԎԂgYGFmG/[ӹwU㓤g0iXDH)jsHx0c NfAGy'j>A?{?:e4f# ^:slIr3Lk9 㸨d D=1WIyf~Ƣ)a>/A$i)G(*QZ&imGR< )%tSV䲋"эPG;_=WXWi*y~rt,;+e Dў@QU~";XB)<@~6V™b9 FanuNok7ᯓ˄ t,ǵ}Ҍy,pA 2+ΌTӶGU`_Oz+ݔ[rHrB͑FK).cDiq/v8沧"tm#I~ShQt(sG2 C7bW}nIe 35q?aͰ1vՒ?zbFr#+Ѐ6$ P0;mcp3fLw"ǜZ>JLNl鑸Q"YF]|+[)vZ5̱;}\x)O%qӈOwH^dEJJU*e\4` >fB93̀Խ5p~"Yc>ݡA_8ؗNYDThyʒH:Z- [ U0:Y5͙#UMs!'4K}9ñqj=Da}oą}EL_־TTk2v{KzOgx is =yU>N? G7rf aeCP jCVwm|l6hזI N"rv`tDyv\$ ] .@Nyxע˙WĥT7wQUDN(gXv[ME &]x1*T"-*=](ؽnbƎ&]j}A#YXzjx pFP$ !߀&2u($I4xʰO>@S8=]8 4Aopzб;˥w0M!K49hHGK=RO&X(C?ǔ[ϭd?ތ"3(1e6%KUEn] [hwyI.gfhlzv)Ws 8м ~Zv;a.9 Pih.׶ 'njwb Kɤ~p]:SGZ_ꊒ݄xu_rNj0:e/{'0?.bwj }W;"*)!`=S2#e;ow8Irg:0:/_\x 0GEM!T%FdIwt`gB]k/6?v3-MFIXyPht-#haFh!"DPb+*끣Z(2?9uryBF,8WCZ&2A' BϯQA0"F7 q,WXeD@ٓ ϯEHvĄs 5-Th,dAh0&{xdqMqfrz%0ʯ@s"g EsigE0?~Q[O5;si} CL(-p~]2Oh ˿C`M ExkYU+YϮŞ2bRv: .[L.$_x<_1ׂF=n̲7ȈA$;ʇ?RqdFʹH*awO` endstream endobj 625 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 627 0 obj << /Length 2959 /Filter /FlateDecode >> stream HWےyrR$/KJb{UVX< !9^6T'g\**WYKӧ߯,a]bWlD4^E|._&Ϗ {Iՠb,UtTνR3&Jn:NzC_˜l{K$ mbSl*IlvakVXS5PZ hfg-ם,k&|&kdZO2BJULiJԆ񆉯|&b# S0t՟74º:u JEt@"(RlJJV/ʶ[P&c1QEx*;81 pc@|S[a"8>9 Œ=f^?CLاP5k39Q'3Ez r_Q_8'"_V$VAv/T}V$@iu-NTAvA)l/\UXQ>FH6e# k#>5XSxu;aGW5~eSg*fRK~cW4]fbKBO5_˚h"pNyZ@K -HnGNH O|>0i-dg3Fԓ֚c.JN%/XkNsb{Xٍm(E2YXWgQ0007Zn4`I[c nX8EhWO|^玪A8B̆,h1)=~(rHR>~ `hj#P֋%|\ `ʩxNEw$q?QZu"BSHNU@`C龡#ŸhVP^-5Rp dVU_Z@ÀǠRHTQNh5"Oyl+l= NS >^3.p+z&nf⊽UPk(F|.G=ܸV3qO"ȷDt7w[-,w)rdPG 7AѤ37Ӑ==GcJ* YH삸< 6{n bsf cKRLsEY1Z&XBpa~ K 6UG8J @|dK~C'86cl{C7lwti|?!YyIc ȂpCX @zly~'3BܳkT ){ؔqz_z`]ngk\ف]8}s_aJБvú&J-;Iӕ%")4JWVorwl{ҟG sK uvX52ckGUk߂F_k(`O{됋 }^G,ˆd~k[[PܩmD^AUȉ(DƙX&"#v %^8悙?h>/~H9Yټwz1{wi3ߚܴC=2y]&;lo3g"u6fF! NQVWx-Q8>mT"sg.B }(a!8\‰UXvfµ9"mQ4Cdr5uBJɱndbg ! x#3~_ǙtaοaVXt+ d*> ~q,nH3>2dX>yK,.RG!Ay :YѠ-kkaImSmx .m\?hN_oޟqړ#$خZ\4aF ֝\7 aCÂb b`І66C}6jTq:V Lsߐw b!  C tQR@:H+,? (?imCo[WџW'%Xqy]]qZFJ-;ˮm@0$%ehlWÇJFE!_5sHkMgT%&3ُ| Qwǎwq6GIĨ1~ Hߊ $+Eރ o"^<S""}B4p&[Ü挨Ej{xvWH>}BO!Jm6$V3`/AQ\֊ Wɋ^.S endstream endobj 628 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 630 0 obj << /Length 4796 /Filter /FlateDecode >> stream HWnC?zfΝe/3E8-eqM); ?9ݤH[bErԩ˫?s8[r_΂,0Yxl;nCw{lYpuͣ72[s< pl)n̙|܋N5]-,;)bCb/Ip/ؠә9q}v4á4ȼ0C /M)NяZ1Eiq^6$eɴbwQGcd]ʾTk>褵]}? dϏǦaEUソJT{\^GInP$ sc,>uٛ_߼[μp$^ KKc?\j+#+Zf+R6(MU+rO?6 6jC%:>ϳlybl_W8eH`@an-e{T`R+VJ/Zp#/HS[ݡɳS>]3j$j_T nߗ?]D^ŸLcn&V9Z-m?*( OWƵK<_*?xwwwʖAIN2frAw쫒jUMU'9UR*̎D^V57t>1f᪓E럳v]xk3Xl^t&g +sBcЫ/[v2X&Y~}fGي2{RK. IbܽӍ+ެ(Ѣ ϟր|֭J4}E.Tgn9fl>U+j_=ʉk^-L nĪzdSo *9jz>Jd?B7KlhL~4. w׏>[Wa%'j8xiZյ"Py/ʢELnX &:ivzB4DH+@ =G-?<^=c3A; S7q ;lFAJ%AE,ɽȣ5fɩ;_R5lt eοnWAjm_ H5yV;AJbLq^7ꙝM'hABrwfΜ wm.wt%Q$5G(R kA@nT%wjCuil)N2d&e]ׯ'f2%G*di\ߡR=|]gk2I"-t, &H=Z;c8r/QlDDjdf R{),1"k7T>ȇ°'{!NvH d(g)4mzt5k-n9 f go螐xM6rdv-zl1([=Ƣ1WiۙݳZ58H Lj* y sadF&n iXj985huch6T+?1sMs8SothH+ TE'I[ GQHI2kLdf%ԖmmӅԒ҆%z_ke6a-;"<:=hxzDJ0a"p%ͬ5 BLzmq[?Da=/4v1\^\.>-ƾhfMp1:p<mRZv-'0ZCwo: Y4ݻ-@_7֣GӼzctÊ{, [B3 l`vY8@KmH[993f2}Kjb$f +GX M˥Cwc0w2DxtgzE2<{.u7F,:KI ā߿`W+UdYɭ_$GgIil@aW[uwG=٣y;Ǯ;;‹Z^'ema8;_cpހQb_|4">o=&`u*nB-ine}(xjqĸ\en 3,i|FR<Ҋ`L$箹әG^ :}|,pqaWU@SIڅm-[l*%,%%49HM:pNg{w+T8x"H&^Fㄋ:!qHHIS.V6ʜ5D,2e|/* 0eL4wF?1?[=yZ&4q4MhGO@O2r&M}T*#wt v-\Û7[bd ;/_4 -Z|Φ#FR}1)JU.×G]tܹ643R+޿zwwzLy<uC.D%WZDs .Ӿ13I ሒLmk&&ҿ؛H#5q际dN qPP:|N؍sbF3w*OW`6ĻѾ$.5t*} "&¦G&{kWG? HߗL@n7g S8'Սܚ96 faJ*Cíai6;UCF(.{e] "80T= [)g"t%6[PDh'O5_u.6繶$\T[8 he 7X_Dӂ3@! Eb < _`Y=c`x@FN{|1'ڒN ] jT3Gc]er"g' z: endstream endobj 631 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 633 0 obj << /Length 591 /Filter /FlateDecode >> stream HMn0O;.,:A(blHAnsBRJbhfޛqepqE P(7AF)#9d<M@!zEa◲ BB{0BWH wV;|55~OaZ~sʴWE2@1\YCڟ 4K!QAc/|' \-2~? *l/JXN{ ~DH9z5̵ZՂDm8<)ua}S1B[܉2v6r0'%8yshٺQv׎,aCdqhbDžgwOyRli#]YQBgaE Uv'j1^3 IWԑň|+*mpksXg/Z3 ]AղP`; &}:SׄKh%lu0!$IϘPL,C?zN^:4v+}~y~niݙr'aYmU1Ft1tVy7{_L:)^u oZQoYC endstream endobj 634 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 636 0 obj << /Length 4261 /Filter /FlateDecode >> stream HWۺ}}L [їe_{ܢ[$nonm3DvG IInR84Μ9O7?' KtW*Ygy4*|]lKؗ783vU)\%yynk#ka[՛}Fp]_(.*ݞm(ƠKUXo?~&IMٮ I2ʪ*w8*-34?z(U~׏7rGx߰?*36>J7ȥRL|b&Iei.UMeQhyG6`~{n8JU"tVɆL]޿c?}:|{mwQDE\'.[j# !quvwoYAL B pSw}[XI FA2za-m" MH,Dq8(В*dden6LL]>iձ"X'uK~cc$dR'.Gz me#8kU }efTZQx=q^nĭ=ImFvQfWb^: ;N853#A<"6!OB‡)jfx;A|(x}^4u4<_FGM(ZLK(sE'(7xQj MH#K I'.\ӇW":G܌Ih=)ũХZ(Z"Fk,b$E:bzg9Z0Nfm]YRQEYyGt\(:>ʚv_{K]s[hj mVK gPF|xTUQg>C,M(Oh,[^@}℡jđPGUeg̑9KܴQv-EO{H'6]gѭ$j s/ǩ]\ SKAA}#l=!!w'T[2(A:G+`tX?P;@BKy^{+#y xFUpn#;D#FMct>pC{!G ֩=U?Oީ?$|֞ry@{I8ZhQjŷo;I=tD<spřxl`1"[DTl QЂw|vpLddGggѬѪ܋%A\ _=#'Įդ 2Ӣ|Y6mQi>1sf9` .Ԩl͍g[T,ҞRE^ls*$ɞ1<6+5o[ -8C1nYoo3MڳE@pKWWB{_vQXyV#ٔ#2;FZKg >i"h$d LBHs'X)[H"7_5$.crlm4(@!'Z /IApAH[&ߥL# CAMg44-eo\iWg_` hl:"|lv~xBh8v Y}/W쬖.M+tsž:3%a&CH\/Qt aΊ*6 X /gO "R{a읎Q"*ޅNov3he3v8},/Y[c'y"] {&xX_7 X*v{(%"~t[6)%7=B7IZ8dsMBɄN2ITE09#㕄 !7.vj9x8,{]XdvjFB BKK]F;-Q4[$5_+9Cs|dJRғ5EsWteܕ&ew 8cP˕l"!bu o5k-!~QON-Y[!aCu97ܥ|DH}4v6ȍs74[V1#ޚ}|y9 $ gsBƼ٬YwdW3G*=ƅ\{cH9F{% 6 :ZC=bvn6kc; XC*;~<{?JoBJ[-FTfsle=Ei-pJ}ٞUT",<$8Qق썯>oxUP"IfM);``i3I^7!ѺKܨW1= *sZR{:er-F-2^-mAZ sXIYY B*|D)nj/3 #Dp}Uwxpc{W9x6^-'o_HWFaWF"պq0a/ܻ fGI7-[=BVFg6Lz6;" v\OY dő5,9 yEqﴜ'U%%Ӿ])@Σx#\j |n@jwZCO"h&^͸W H 3^# 8.Li;sI`-o @xbWÆWW>0 )H7QAīΊиHvҔ k1'vWtPΪÏņK-y2cmZ:d}/&a4{ޮX=$F 6u$|$Ҽ|%g)ɟr'>gv GyI$ psGvfٸ9lѣeIÂ_ HN 4'6FYk ]Ar2u8E LxžSd[W4qKGcòu:/jͫũ_#jM(?3&0\Rk۪Ys[Qi ]N7tɭ"!EJO L)1s|+F5zD|z1tZ~Tl yCNͿKQuB* U9lZ8hf3)Cl* K=@m\0waľ"^`:98s<0C{gODNd>$b*ȟBtg;tY8%7Lv#VzѤ(21Գܬ\%t4f|7CsfpX;c1/Y "Eꉸ]qAι$xg$a\p yU<%B[Th+P(Ag *u)m{dt)&=X{PgTF_O5V*9Y59zv`Q,XEk1]+ f3߿=5- M5z m6~,QQr#LĭpjRзKf-SiZ-nGa;U`Ʊw ˋH9ws]:ƿ]xroɌj+eY`,4ybe'cg"դr.Pn­qGIC V"JS}]#_2f禖/bTUR}ԗ0aL`] endstream endobj 637 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 639 0 obj << /Length 4335 /Filter /FlateDecode >> stream HWے۸лcu^qO/r/1Pfʒar i#x6'cNۡRx$8H6:՝Z`Թ{v#Ǖ`(]~߂G'kiv+2/-{lkz;5ɝxwB7Ә:"Y%r?yZr:j ƟY,;7-$=; ,f0'Tܐ/poji Jpn51΢-9xZ֜fj;I\/$ g\&>T13F$j)l1ۉ`ӸȂ"p0sjA .9 Vfw=y7bƿ\V,+Ls/PbivuPT;OOlO"ͬb Ҏ$f.Gcدܬʂ,I.5KkmԨMVDl[{)L,jh`bz;Y?HA9U Mm:B B߻66rXM:ګ[̑tcƮ1.\pC?P& ̂&&/8Moݘ08%`,AKD"جX!0}Q?ݭ@x g?_"ЃT!+B9Zm}=Az ;blbe`Yke-掎v-ղ6D`.=UAo^%󴫨Sd#T~st;M}-2'BKQ}!b_B_O<|@%3Mnqåt.H2sd2'h+;te ZQ$Ԑ DyLե #k{n_Άh"r.Ս^_rS[koqgvgp^mW0 U]"Z^h-j,ӕrwǟď0q(uϰ FxG]9b)H@52:>qSH v)h+ϊ9&zJޜPGrxCqz1(;-О tN7buڽtf~{إzfWYu2@D@e?.v#2HvVH)& ,m8(ʟyɸ^yN`U^gKM#AŋVݢآib{v~Fr*[fSԥʎ@Di}l#٣BBB8kQ`kRGߘE$;ȕxt)&h5f.Νf,yrU/eD>[$"Gi6upD}/R(M@$e}<2yM%`he=ƟIA/jslt=eu$9Wۢm3H EB&I"KҘ\S>$Y>qWWcTu\0i14mvn]u)~LFΡ׻߂]i뉚Hޏ?;9gKF}+%O{ϵ-g9t5O`kQO!/'5IhLU gEtg}8@Ơ)umjͩ4C?Spo:Ws Ĝ;էMb|Vs(czBD{  .)"pDHA}(bn[_)pXl0acbA_6 Op(5.YD}"W;nM=)Tkнxfޱk)5NkOL_[4 ±p |̾:c,C+B7tGPuq8%uγf0(־r0CũAătވTP>yh}þ©0 ZʎzOݙKUn_`s2 endstream endobj 640 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 643 0 obj << /Length 962 /Filter /FlateDecode >> stream HVn:a?GkBa´SFӧK|HbV:N:%e: D^k_JG׌yWABB1@Z}`3Y1X7K(!}yGyx.`F>V|.v܅a8$ly7d^dg,s谼$=A?)D4Y;M"CƣԳSJ-3^µs,`fHk]$B7PN\mKd׭+YMU\μ|nI݃Zon3D5ozJJeL6nvtoa' atV(-۽գlYJ߱|Ǿ1s9B7f7'e"3蕏>Ml>8 c?u.EnZh~'֥Z[~bꝨ%7cmy [q<,$mXmDcNo<}lT9o?J\?Oxp+{dޫ=;C#?%vĶ5fW W/F7,1{Qj {U:5WCt%`IPAQ=9Gr[,OBczqS`כ0f &8j,ʧ^; ,q9&hZ(\/?Ġ*|RV fYpmjbJM9.srM#pk5b-&VzM u*7 # Im;3첀P)S—E[AR_V4L Q:X%0kt=A endstream endobj 644 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 646 0 obj << /Length 4478 /Filter /FlateDecode >> stream HWےܶUF9"(VyIzWc-RzĆ-j-;ІmUӨ^ό4UoX?cxds|H;A-Qh c|}F^,.\|j[?!(}xkGAy5(OH@9Zӂ5o72qvZ iY䋾Zlb7iCa 0k8eZjw`DRԦ{n %DqaC8a{$oy=2 k;&rc^y c5teU@U79Æn\%n1*gT%97Y g$1a|PNYV'7zK{45Y`1̄s\Q}6prvVT8q!i;MNߒ;v̆ݳll#0s6rUA(Z5hDTY{ޙċFA1c!wCn^T?һqZ,EnO/!OaTVus ': W_d2WksBsԻgoщNj;z?/5%N^ ,_qMmžfwy KFD{O_$mSAIk mS#^p8(y^z\7| "> [x M3Kzng! уltrZrwƗ>*^z'g^ ?`BPn8~`Ljz2|;yYSm>uT MIdoDcܣGt;4`62kXϬ#PGU1v L2xZdF@ #|pPHmBa1|a}tk:\:+xvnS9ӋAp.9\V l~1ԡeo@V qcù& Fb+/(oZVI`v~)\^jHkôtb]%g˦ydu{QXDuu`jjax^-o4{{S#3y/D}ZvU}jЖݙY(Ի"v*hgK^}n-sA?C<R ϋ*xBDf',6!tvѹm.7;J-(-g=C/5Zڏ̤##`ׯo3Re",bK0C k'T1 >UG ]Gf aA=k9/J gh؛+ rҚgԡ 6 {׻ZZjPy#E3xFG&}-Z ;ĥ6h~ޡWviQGg*6xdy0kwttus(pb[X*ق۾Xr(sp//'$LOMi"1'M=o* s?}4vnLDH!wA[P%iȎJZ0jjз}GgoQZ̗FW;C3i*w8O[jkҰ`D dTviIuy g3,b&*~vs.ŨţP 0WitLYÞjL;zv {vu2Na|qjNBF"ы&Q?}ZUk^Q")D(,]^"=y.4ăՌov׉oɌLہl49e}l3# \Xa;g)M(s*hhT D^r Ni+{qoR02S?WdRq)u6 +]B8rc{Tn*ئ20d5!=#u+z1@i@@QC؟jl'z84xXƒMn:)\=4j:iϤY~M"3gg1)ʗkMqa-Fݓ[}/'ʟHo~qqvz\%sf%4k*%d߶/(RJ-?^OU˸n8oقڛ%w}2 N*^. pmJl⋊E%fxsuo iB<'dk174a Ս p':–%D.F?Q#%JQY ETmkŘJ%j̱&zwvӱ|Yhi< `ނaGߘ$Y@(0qZ= žA)}S Aq$/<};VB$]i6Bck8)@eXn-ț̌%,#:2uN">Jo,M:mv`dza\>㤇r).*`8S< ;^ok{?SX+B|T6\HzZxioRcl'mHu=^/'ZI ر.D;[1J&ڥFU_M$.kSF>vZ{tZtO}΋5'lż^ԓj<]̋-?R 䭊;o ݴT. 3\%CPisaz4. 2ھ3ʹ`hqHgdROBNT%jEq,Y )JGi|OAt}F4a5otowNtCTryh+2'Lʨ'qd,ıbq>}_Q endstream endobj 647 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 649 0 obj << /Length 5087 /Filter /FlateDecode >> stream HWێ~͛(*/x` xEEl.>3TuS"5K`ذ:u?Dn'Bىtl$40NCsox{8Z|P܅Ax8GX>YxpỻU[(fT V|Φ-;eZ;w3Jxj~_1߯QX${*k̝^GYL`fݸklϢ10AV֢FAJm`P)t́\d:8|DR'KZ =k M̱}\Ua wJ5#uylcJ>)7C%*)+޲M(!n@ػ8(hտ~[aml#5w:O(-!j'? uV3yk HI2@T݉AR@m'aķ ?/R`XT&UȮS&0U!Gg5MAiL83lls4l^hľQśhޗ.2`?uz>]PWKZnڋF7LQ%^hEi>\rKmZ,])!y5@ڊCO}V-vgX:\Ѕ`H$ņ> 8 >?nt˻'-.)b+u\ WV[vͦɨc!,˾.i dđmΠy-Lvэ b/Xn+O gz+΄v+^:槼 ¥TSjfJlGwm"[;BQګHYsy@](1OA˷3Q <$)j>€niĘ(.x2I#/qԸmWA6#&՟wO"`1|{ƉIz &л,ί=^+Tjj5>+")'Lhnek\"f1b\pOuaԇW+xvUE#Gyv|j]v5j{b_HV$\~BMyTi +u+e\v.^NkDjksAkײV ҫMOc/)sGZ7\ً/ۋvb킓޼,iZ}\Y-S;K.d-+I\)WrFlGθPTfj†Ŏ ҷ3Dk-(nT@ޙ[aނ@cjM]5@E1\}zeo\ނT zd\@0:Qs.ȓ>NlvP[os%8&fP1:cGq߅V6 G[G`P $/0L0i{eNW y ' q0ă|LU@~+Cۍ鹅[p+OP5 8yFdyў˞4Syt;T/HYw햏RX"⶝fâF7L`\47Ж,)O+y 即\5~:SmJk84]075..}R!g4zB S~ӨM¢$ߞ u5zԠ&h4Uq* KI.`|߆*y DFA *U˫7 PqO<'e2GyKMI z I#'NwM_oDhm=JK'^ tkqaIT8K#Dne$(mNb:2v,dVcZnh7X Տ |ުP_nqQH--My& b4Yq|6mFpF'":9r\X|}IΨFH;e迍jo ϭXŷu_ FZ(& (Ho $Bu!ލ)/>^ @$⚀2nŔ]fm F)<(dR ʵ4h1o'Z5PՕsqdP9뵍_y?%Dmk4ϵ TsHbPZ5+QB"g6c .8Q UH*b˳ c;曻 ʞ-j>Lfza_E6 #>W~x% 4GEF h컙5(jvy$ȿXk]KK-rGƪ3i 6~#uI*oBP' ,C볦\|G[\J[/`qr_; endstream endobj 650 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F9 54 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 652 0 obj << /Length 1336 /Filter /FlateDecode >> stream HVrFcA8SKĊQKp)b0g/JV% b{fzzzݯ"&A$fK-xEt2a?=M}`dOq17IKzoJ[TE+dSk^?rd",JֿLޑ 4͢"4Q&Vs~-D&B`8rJgIV ܩ-9_[K+GJSmI[1MPlI'58jOLEzLsiG$A^j{UHrE6"<9['RL#kX6LF#\ҝg F4 u>נ/9蒊o_3'O2Yz>EYl+|~7$-t*+i7bEe蟴+8P$%*S*1Ҳ-#Cu=f,cKo˽iop,#,iEF"E[cBqiI]N"5?yؐܟW$-]řVo uT,K2{|n o]AZd R D񡁬8 B^ڽdDۛaߞx<ha6E:3jkf)k䕄W,VzKQAu2E!RdQCt1L4ЃkD[(}ݬRF ґ YhPջFFDD4+>s @$*(8t19 ]n5Tud`/?"M\"gUV*<㖡_X67cCs.fː to-$tEM$;VHڲn3[kM X,7]+}Z,<^Fy L"V~1N,(C μ `<0t7 GmTqϑ_"ۖ s%X3BوՠE[fKY6c \cCoM%6 Bsݴ 1 }fJbCj˙wrv4G`pZ4NdQFV/gNPcJ2/8ž'-A+L[#[k P'e5{g" uǣؒ&ޣi&u,3fAXn lN%d[˝ } FϲEl7a ~1Jqhf_iMǧQ#oG\Q ,I܃x s+Sf۫vǁBkl'꠫ɿ @ endstream endobj 653 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 655 0 obj << /Length 4469 /Filter /FlateDecode >> stream HW[v]Пrx}I#8I|4&#<8h@4#_YM[ݍD>уhTWߺu짟=yl9KI2eKIeV噫yww۪3q]7` Vs/\ZA\[:L ^~?*Ɋ+ՕaB d; :Ql9:VxnmO&]yqQO M} @\1^7vv*G6o%rɽ2D6I踩^i/zlU.ŮEm {%l]ݵ;T써J<X:K`ѧޣ~u}z2M#QPϜ/D(?vǐ 6uetdʬ d -guՊ/-(RJf;d@ [u5.f_yYv\R\/ C<Z$gdXQoe .+:h0 ejX1=NN隶BlFoBS_(% ]!7zQCh"1>D _zEFhD~c`w^H{T%J^=-V;{KY>Ylгd-p~*,#Dy1D:D.Nqš`'XnF:tp3Xek tLS lsQ"TV QJI04$:ڜReP)`nN 13~oo慏)0߳:<>o$]c%Pyx$<كNPg$VI|r>e )Q$̪T E8/ѽ>4qOޡK*s=T:%6]TZZVh}C 9/@xbyK|%(뜦EVpdxf"'SZ>)trj##YsyZn,{lhW hTR'HӭJh؄SQj#H }SRQxF+|kILOfdž] p@VlfF"z`mhc9~2lS3lZ,D=]`pci4gDvLyKKLANJqLF+M3`jBaB^k&зiD= tS# tCˈ-\aBcq4Yv&JjUaazQT"߳""j7e-}tG}QII#a]?z2Chδ'5r/%ߔQl2sT>BYrsB4a,cb|RR*+\䓸 H"NMS[ `Jj3 QR҆a@[aؖ뭴s##Ǩg0{lqG9j6gોGnvRl/[G6ͮc2NlPgAbWwגVʚM]A MLtLw92Q޻eiRAQkE4f7p$~zqo}5pVVaQѢx}iщɭj{tqZLo?33 [PKʥWL唬皁5aQF.Ѱq`<ЈSDL]F_ MEqD$oU!mͯ7~yˮo>aWw퇫o~DSκЙMRHF0bQ (]Lt gm*uo'}R ?Fityiԅb]h;azO=k=#>(8GO ^fr[ Ѭ6Bska2:Yw1ɪn8su)@ 3I.2 8Ik0L#!?WKnF=A H"pA xԒ:G`Kv476P^UuMx11z?dLtZXbz9ޭ?Cl4-E5{uO4|PhpW`,6Jd2˧ŽU UesGz{ [1SWFb{y?b4QWiSg< ;˟2g-|˓ecz&$+[{ &3BIZo94/A%dW7༙ lkMVo$&EGk>T"Y y9R o˿H 7 p2_g"ߞGsb&SH\Y- ύtw iW Q~"8jέ_h.r>2՞LWPP?rV ,`I=eb@-mi~e+y}HE pZA(:؝ʮ$Y[-Åc|/CvŁ˕ESƩ* cC$S+ ImWۡ VBVY"y*'IܦLpVA{zxAzB㶠!;V$)2^(}]вL?Hm#pdyIZ$) zQlMo2L9qaA&'P:郣q,b^ȖCY&j]#8JԴ/}Q(Q"&9מXŭSʪR6+;-Z+'] Yq,!HE'ʪ/BR:IXB+YY1lE=~4(Fҵ&HKSid0eDgU҆zdAHr&+[ݿo*| rnO ւBb~<˧_!&~*20ͯ:`%uĴă)6Cu&DnRDDex{98ډ~[EŻMbӶAK<$i1}EoP-|7XL1hL@盶; |.ܜb1 1{out{|Fy.v/ GvmzŲX=y`v Py>8tK@Fo9&(5(kēOtd#KIو0͢t,4S1zVzGjn!M"^ԱWQfԴϣ=vNB]_xɶ7*8\X~;o,QU1Eߴ1?-,\+DC\ĻײyW3zG0s\]B Kt*RXxh_3*tHE*ew̟r̲-l}[K/%37_[z׊S̶eF1ɗg>$4^seZfxJzbeE ϊ[ v0c^Z_~X9rN!( e7OiQ„]IgdP>&cR2IƟVy-Q>&>9qjج JRxyr€-ꉨEf2͋~qWdn)ωHBg| 4 .-Jh?"O'0Bp1'50i`/~ jn.28/%[5d4[dRc͚κȉs4F-ZfCJb`,wui69^ˣFՁO'zN endstream endobj 656 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 658 0 obj << /Length 4734 /Filter /FlateDecode >> stream HWےyR\*u9bmrEyCr,Ccrgp#W\ry%,so: E$w, 6q,Ƀ0bT߅H|"qxT݇A|a,RYؾVAY%(޿H맟ȝA%x"JS>tm}QktdR:e'Nl)[g%UV'H )|1(/]VȮkض@!7O[јNț uZpl|PN+K9gծ aW.)%.耧߹aaűz?(Qe+ˎaBۋ 8Afu+يR>f.*PE|h̙V+eedjwWqq BG ρ؎sŵBSNȒ %ocAwn i:\oYw^cza3p'WVo+A%n)UAÝZ ւ .o[tzY_\:,f/i\K[MU3ldj󗧓b ETYhUZcp ¸9ڴvkp:ˋFK",J˄HWkeZ U3rʆ#>M>vcvL|gbt-vҴȝz[G3XqGr}Ax*BB.'?ZQ 3!LUNJ(;jMTB{XDGL̀Fj" F.y$fBP+TK 6A矏1bn9.~bxqF ];u8ILtBVSVЀp[dz->DZ$ }5>Qo0=?1P'05=%X6W"ݟr}d/v,fMoGG%iNt=7g]UL(㕚?xɐi4̷S& 3FaiO4&i_g.]$cN Wz!$A W)bТZ[}k;|Hɳ찍 k*Cכ-f x,&.3K;:MQ^w$Irݘ%MՃA->í}̾硖Qa߬u \gF3#&̽R*|SRs+Ͻ:uj te2`1A`<+6GÙ"QH$*BoIx@34 ?ZuY;-Tݹ!urћylq!G(~Pz} l }** =y'ި=ql J{P]пKWFEmv 7'[(iL7\gYb([0uė3!IFa/{z s$3%Zb5ͮH=E $9dB S(Nʜt|[j!"Vǻ, 81,磮J/Gq9修dwUɵ ^O}Hs[ e' @b.Ҳ".pg^wʻP)0w$qusŒ7oQZl&`IdW$]B؊VÁxn/6βӲe~ O u_K]ZMyw,O%%g'b>ƪYJ8-9aYM%i4qQ?[VQ'g3kҨb#dW?)裁$b\ ˴&JX~eV]4sf}n~QץP"AgG&H"kR/_}}V=>(I Q0(x`yhL~_ze>ϭO< &e9H%gG짂6Y9Gȡ =c0B/..Oٔr ^aONxvFj48nBڪ8erS2BY ++ ۛ/tDz0&*nƨֵalE"cMNުG)#̶.';X84Xm >v#V@w@ol@lNy `1FLOv*BhNt4 Hr"n]dZ [el}s'Iwv4O T6;y'O8[w%_DaZR:޹7lj nQ13L R~v&xWQ/7U7j^/ 9#&9}aȸhvMgD)aJA[®/ͯT=hW$u7TUAc6Nb;"Ga`:Ŭ^BZ$.ϚMg2x3x@c|'} " Qө-*iYA5T %3$IIKJrt YC50_ETjq6SS 5)5bQ4 <&6݁ U-lUA,Y `-4Tb/&.[8#d)k\'A}p`?w\n6Yvv {MiT>ؗi+^O7iUq{^#RhE=5ŝV3}"6-Upl0+3: -[a>6T=^̂Q:zIQ{Ms hcϴ8km*O -w̮Qg`oެ g; 5p|aGs2Ή2,EI6&[S4ki.XFLa 7T$UcLZFոGqpDab+)R/b<`<#? vG?^m' MZGaIJ?W[jzyW62?ER#+$C+ϳR{G}%=^ ϳgDN~|`?'4˖\mkj :/'\QU $޾l7˜zD{Zv%F0K#?>bDM_9鶃{^NjPD\|S@]r(4oɩ {tkz q5\-{uC|奈}Iuϒ`i 5;?s |O"Ѵ؂,-qg÷)<}寯Xm;p?QcO<.)iec ru: HS~tOW3l.Rf|YJ8=ESI. p +ru(Y-dkB?L Q`}Dd;M;i7bBvRĿY¨#Yrb/ ZQ&e3d[#u.]%!hzSr88u/ Cc$1Rcjs88pf?kd]B Eϰpx P2U=z gVc4@[, RWK @>Ҧh=DUd'TbO 0i( endstream endobj 659 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 661 0 obj << /Length 4815 /Filter /FlateDecode >> stream HWr!|zxWqN!ڇ4aj>ʲ7+=u ͅw']' c]7t7Cy\p\${QHEJ {S?^"/aghAAJ(us*:ʗ8;pqA%_~oU'OmQ=JXj1~o@xQlu,*xyy%J\2}ԥF?J.՜Du[n?]8|i^bzǮ8`FPt+94sm'L ՗S, |;F)<i9u-N]#; ѥQ)ӫ]tO91{[*h3vn[}qOy-gK}v=`$g/B#NCH;/ɑ-GpUp+#/8l4FjzPN5HکZOl8tn𦖨te#^tKYI@6Quщ^sGVjG&- 8G)Aߝdgt[ jeѕGOx-L`K-Iɪ5.!F ZbUwF|Jb\!GINP~ah)CWH8]TI#kUMn艿l zNQY- \}C!Ě0GVSJh+ xvA{wXm+N`ցAz,A) k$jQ. j*ؘӎ{УHeu&7u+͎%fi`l3б]N2eʵuƓyʟyT'Y_6Ex #ZoӚq٩1wK}NS` W?})m#}6<ZK\ `DYu(~zCE2 ޫ {Yg9B }GJq#M7-҂ޯ4jmilb['coEz/JE85q#k-Őf(. ,I7anjvTpd;q!MX6K%Nt\,BQw^_@q4E]9GlMF40Ww ;*VmB[m䵩Ly8WZ9:g3q&M&SnMK9vMHZ| oIm+394gQ5n.4ṁ?e}}۫΀63䊸xܦTp,s& S'e0B١qw@kpnt=;ۈAR+:Dt_;Tw]ۖîl2wS@/ԨxkZ<{k)ĭ',kBldk{W O 308T”]^0sEIWGk06㓃W4 #GtnjTsݤ/8F6T۔ l7rߪmve0 &I ^IѺLEķb6{{oFѸ-9xn4O<;TS^TeXKݕQ\o6`m?Ff`$P%#]w5fn>BVv2!0D5tmi ^JX:n]n2 |]o U)ۙZ˂͊nH6vML(|h4$q${MNWl:gz`)=]Fy'g͌}n6h#@*Y`I`+z(p҈RȦE.iOS Im }`Zז РiAk^fnݧ賵}~3CR@Xp|nFzܰ1k3JQ!aT0vab{%t|: !{{79=Y>v<6 QZg>^CIpGҁMNǃui+nkkNqb?/FD9QwTZ#Nj29f Vauƥ]@8;5<)ե3݊vbv+[[b{`=-hFå;],VUB|ÁZكzZ7.~߮`|y6~773AqPGbAOOA(n3w e\%6!:XJ= dd##Aݏo.4RlV$&X-ގRfdWڞ(< zm\RN#'ܚ u"&4]צQHG#.066Bs-EnSؤ=legC[Goe4Lߚ ,DFH(S/6 <ՑxٻXYu_-AF.Dzq H5bؗs8%į"ee9@\pLG;Sx.[5+ K#m0 򝰛Q\dž6 \(XĹ#lpB.ru˂5iDbnwЏPD 'm7=ZwpNfDe~ Ғw 7~}^OrW헝*iਜv ڵpjU&aP F/Ԁ,_G>;)m"6b10jWVWr&!2삇8v/14<'>a2p=1t m|j dO#iz\]}Pmœ0Lbb (~+3 {pFjs=%P)9jdY䎠|Ӣ75C|eܙuz)yHBx~*fxr;1%% gӰ-GtЧ547\@?P1ۭ]M18t ɴ6~>v;3a=*ՠ`,&73lGE;⟨]?Ʒ] h"/)x (˫զ,Dq?d—o"Blzm5(]LR*6E4e'KCdSpos|D9n`CD,!;`²}<ʞe$'siV!b >bۼS~xF i&fY Zl=o>?)qYQ3P |Ny2@^Ey(X`E\G-FE*nV^Kh50cW=vtٵOU3Aʗψ3돯AtfZ/Q b8o<3 冢'lU4?B@~Y}BEa^Y[ 9?)zfb(t܊_4jKgFf/]j4bk&wn(P"yK6X"K=+YO;|x#?Eܤ٤Xr뭡R;U8ǁc9ZA7*o:˧=q1SNb{O[i0hP+l,vd<]($$Y$ۀfRj=P<:TQOw 0751 endstream endobj 662 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 664 0 obj << /Length 4631 /Filter /FlateDecode >> stream HWr<)@\Y-IVjCpD p1hyM*Ӄ%\փI==O>((DXQJ*<EF_n"涼XAQ6B7iVVVɶ܉ _exJNJ*v fBw4<${ ih YEx홷! U0)LsJH+ު? !aUx{eu ȚRJltp'Ӡ^Y5N7?:bLSq>̮*M̈́nUZ?91#;Ԉ3-k$l"">5nsuqī, ]2 %?Nr8uۿ^,&茜a諄ԈE#?/,O8q{c&5i 'L+Rv^7:` A]ǏaKUsro&Jg̟2LA#4'lQaYյECD9X]bת} E|mFpîX#!:){tU ~qVw%=NVVݷ!Hz FtXh1"TtYxfaI EeM|ǝq,1ͥGoP2ȆҘ= @›hI0p(Z֤zh \'Q}G}ux\1)R|m |h6͕٢+w{jID*@wTNH={g׶l>PWINnm<8 QrRзpw`L$~&M i!l{`(DE"~X?aX(NO;7.;R;Wzs!;(\W%[J?m+qľ#Y{5cˉ))'ȅhL'bo4735eѓⅹ#`ov5Y^O{_gX ml7qLEah84>KQ-VCiLGݡQnN8\ow,Clah:F<ŞgY<_fhlZۗޞJ3bj'f/ex?x3$O PYo$EQkwn4ur3~J= U' (z)C^"h#]z30KSA+{ߜ{wIT@[ռ Qd/brE+Z ɿ e<%+6zAnΟ325:b+ʈ[P=$pe)7>_[qqȱǝ.wZQl&qdrɜh{Ɯ`KOak~Co&Gx:s:v2o\y/•b0Ńi\g ⩗ UuQ.h oc fz;PIpcff-ϓbm.}g0䨴~9RA\4"iU{*#F)ڡۑad}"9r16ݫL&7a: n^:43r])^ֲZ28KHwF{eíIMl2,F6/~c #*fjpiSVə &#> ];UiNs;P܂AܐEm0Zɴd'EGTqU)')r;fE\-i;d;k=[+x[l HVlA0ձ듷,|*HrF ,)KV\7$$d"ʾl홺@'@snoͣSFA)Q%+a.4̥}%U96=ncMƖ}."&xC ~TH U̦+xoEN~ګdm#~AG\9%F 1/Ւ:b+8;Ay4\rxmwF\lB-Z$8%U 1~ЊWhK.gs-E9|$iO\-}C|v}sаQ IQ. P-Kl-_;x7.Q5]R8 W ;Xq 6jS%iO",Or%O|ir?!ƞ\;DqRg{_ʔ ,7:f;!VtMhcF2MC/ 64VMh:{h;]A?8_:&G4.fh ŻJ>7pFCVmZ(dfl4܌" Hz]Qe[XCkB|6pf znVXjV0/]O*|.f< K M#,`8~B]'Nejg1I kva_g+,Cb^}TZh_7zZ vܿ[R( TԨŶvwv$b[z1Ԛi*ΰ 46e4RiDGJ-}x3?02;7{1av[lHCpx/pLMF dVŜT?fhI?jn20$U3s+B~tCٷS}s ̖[7펼 _ɲVCiMW.e]d3´4'|2j1A6ٓ2p^Lw7y^(uQ7v4O>'hj.NEJ~w/;qt+\ ʔeTd`Ͼ2ka g)X!]֥H׹/'Әz7fo߅Uv no~u b8pd5!OsuF<_\ub t6tɓ1G_ϦjlYƼx;Q nvB}6!MBh}IS`KTu>)jdd@nm1mQ4i(α!<ٽPPB:'͎(MϓCfJ?-{߀ nI޶Ii3ڶ pL3&|-| I|nїc;p,9|iUP-$P% 1n4f?M"]yNQk:CDDE.9 ZWt$Aiy\6 _{)|LO/GE΃,5Îb-ho휗3~A6pѢCsIxua˱ʯXzR- uθn,m:뇟*GPdQo/Ṓ!f" j<آre.:8\'oI3s.cP7/hYEn1`5> /ExtGState << /GS1 12 0 R >> >> endobj 667 0 obj << /Length 5326 /Filter /FlateDecode >> stream HWr%%H;&J뒸0X @'!O @PZ)}3J櫳/|$"˵7g%gzd]yrf[md;;~Dޓwo*m":8>;;&%aJJ|9)Vd&Y$MڎCo"g@%Y%ɋp\%QqMNJRRǰQ*gӁ7L>J ǥ(%Uu%f#;QD,9ZBU_4똲"O6EpmكcYB $8hŴc:Y<r|PJ Zm!+W>|-G 8 XPQH!)J2QT  hƄe:S1.#Pꍛhz@WP18'/b:lRuhxY.4:\<я@ؖ [چג|=H;+j2#O,"3iIBކ K35u0 rgf:_RL}}wISo|'ұIr)%-7no>_<l{cy4eSK z͞.-CIc61˦! [F桒j?p>?! 40z9Z~m:ArN,ͼ,ūOxؐJv ;dyF gٜi l>(*>op'"H%5STlJ4(|=G=Z@^ t˙#r(쾉'Bl o7'G+o>'bnU9L1#e4wl3R }?SUnI"(}CAx: ,z]*© ~hK'&䒁*ebcs)G4{y?xR'r5ZG)&dtQ[ԯðDBɡpPJYƓ<=Pf/mE&v S5A0yKj][JK.-f xՒVm.JMybyY`oyӱl0~^3=/a>1?nM>ٚb/`tYw5t=1YoLM ε-`dدH] SCAH"\^OUS6W/ όe->E;kn`=HO5V*$.pQӎ7,mH0m `Me]k99jX7Բr=OLGE02D{O3ubj:+8UϾq*_{ ,`~ kj$xdz|Chbe(OE܉,3Di4C|%aՐkWoVJΡG^b ) N gdl UBy {3P EnGC]zKr_dz G2vNrc{{d@Ѡ_fzt`Bfg3ZX.ᵰ>] PYY`fB"w)PxiYF~3'N]Uӏ*O]an~T.VG8`}Ծ:{窽(~I9I0gP]}J9]ṇ#m2'^h/]/^)uQx1\0 ӈMLp3ICP﮳qpɢ^5?LbVBےvxl,K4o2@ݖo>t_CɕM*Br1'{!\f캖kMu|O>$A57 gY5O{?}qZc`dN)i  ;qӶNA0-YFDR-^K]̜vk=Fo 9$l/M09'|ISssp4D"4BN.NE"17ax.qU.N\5'~ܟ{8aQ, q̬{XްT~H7\Kq$kwv 4#/M-btIWRMfŒ=V׼VكVYOl~ѥT@V4KsQ0Z), "W4= ?:ccANǚo:U%;=d +xG.i̸{J^iG7N\d /)㷤bdC/ih03!4ã {Kr nP6  {l0.-]CŃ<|H>Z9Y~HbZ0Vylۇ4 $pF G>k ^Qib :WZa;`\ |u~j.y'hv@3;7ƛUAgT`٤5==@^$Ӳ6 $YihüTuL6k3o2dq]Z]0$Q$w<˴}3c.;YYy)0]Vͧ[tbD\ΒVHEҍgF7}CB2tQ84\ lVC{36l6I@r- SigTѻbo@|^47cqz |t3.9' IW- 2}hQR!qEW:+RزE)qVld* &!z/l_s|D;/@;b5mh7 ;6 y0нqC68,DVhz̦.2IkUAŒ t5CSʒ|aR%ZH2GC:~f<Rz$3hJQ ə($Ny˞߁dMc.fxv$޸Zw M2ph B 2ESX^S1Ќt_X|3PD2,E@Юq śG+C%n(f8{ݬ t-g8)JqnXIR* kv&j(BrZY/Ыti8`qeMԕx9X5Fޯѭ/QQ5L;a`tZƊLlswxi#xΉ$/{r!7 ۽7{m);p&W mQiebbnzMr- xa:~%yKBX%5r@lQR{*怀H 8p.(ľ3#K8\㖋LaNExD, S+n ueAX!h5}5vNL2xTrZ xIn-H n{ZD O<*IcRpK8Ĺ=Ex+\4\;w' w K4-bnΌkB]{X,3Z MTX>$Ld`d ݢ)[+еf/Cƺ3Z}g̍s}K^FqV}j}>@ȼw|œ|S{pJNm-콃|BBgED]5;9)bD1O ˷\ =% 0^' endstream endobj 668 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 670 0 obj << /Length 3123 /Filter /FlateDecode >> stream HWYH=OyBb3jslG쉉vdQYSIF\g UL2p1`x|:A<<'qk1:G+=qu}XdnLYYN\k [7dn /3!/ZB 5 ( c3s]ؠӉ9Yx|w|7W7]߅'^i`z7kȪEt̯/O!j.hǎ1Ę0Mc%^D 3x7kS*WD (mpzyx^iKSeDD-nB7Ugj-ʿ!I>Y'J]8?|r mA.^s%d$vS?h XS/$2 jDfSngDY)ꢪyc݊J8±,iJ*LO:aWXD5٬ r?`#x+m{j3L0EG ] =+*P8RXe}gb%1-bdٶgl|ɗ >5i3a=נPo m>H' ÇU$\ܾ=ٸAc^ڵ*e] n>4fLiTiJ%n 9fFY}4hnAh>:8$ipj^!Gx7RY҃0. ,j?^1 ؋f16iqzNRBRXkv5$*֯vaRZȭ9prJ7{aA~Įg5Ӊ+e:iG2Kh`=`2  n,zUՌ#1h _G+̬ Pg}!\_4N?Q^A ҚviW44#`"ȗ\ҷta._3+(;j}'4(A=<9FfpX~p q \=\s\?a~fBjQe@ Ҿ⣨=hbҌ߁`q~ͅA}w an&vhX\zvM4 3bGGQ; MqGH*QZWOZċ&p 4SK"wpfHeKnZn651[:{I2_C[8*JR$1xϰ#/ɳ0 .k \FAz=>=^Ъ%G$jt7d !ÖzkʵBUyfye'cb {I$*`׃zhD:[oCM <aI[?LѤW[H\7=c pwu)(:8)fRoH`亄l0+Y,e52g~v՗ qxݮywn" ]BY;Q&ԳE8 ap c|. (Znpvᢔ.ڶ7\eyϡut\ьz En0`H6q =UeU&bAqV}v NLʖ>@g,N`p48%$ɰ]aӜ$۵S/J6S;U+ap潆&,p1}3im/[m?]Ƴ_ WYڴ1Th5Y~VΜQ0%kds&;Ǐ{&5;/£Uy6vRH0#!bE-[Hk5`aLsGn7PG#Zkm)#d,Z8ȩt*EaguI t>*ъ..FuDXfn^8N(ƞ Q6١LГ^TGr+0afe1MR:֩C C\ʲ^7eqI<^:?J ?v>sЋCu=Vj+(""Y9K顒'S[1aq7dREΟ: vjlPΓ36'uD븦ÜgWC>1FYUι&kOH@ϣˠW< 8_>Cꗄ{ J(OՏ.cE endstream endobj 671 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 674 0 obj << /Length 3242 /Filter /FlateDecode >> stream HWr۸}tH4E6?v|:$[L%!H{7(Tmgg\܏s=X I|05L2ݹ&QlG.ƙaj=тU]YI 9S xMF>P!;a mCU5a {2?< |a#)VJ.ً/?(̞q& -׵#L,#Ek ՀOY'wVw*;2SN`7 ٛ2 .0G%Y+)t_ kJ6 J+T?sވ5; bK }~G&\c(fedvMJ ,[ yeg jΖ{gjj|;L<̃)s^iPFA]G[ m@HT0N5P#;DkmU)*rNJCEYY _2!X^Gg㣨*L(PǴXVgf~v~>x1h?~R)e0ٰ"¬nY rA7\s+?ohzAC}-H}w;Oeě%稳B}oy7N ^|ۃ* +Ayoܢ\uc!@䩝_~e&=[xW)J1.m- Ԩ+=6`qf0۰&p6/y߃;y\Qz6N*pxӢÍ_ֲT7d_Z< xmAx}n~^ɶ`nj"1"v~q*'cר8">@~\m}ZL#p$&ՃDWP aϯݤ J ǯ(H70aٸrȗZy=1SKO0F\o`'=sX_j80 &Jy5JNmSjk8NOY*(W\WG6+9]NwgZDqskk5eAxNV<Ɔq=֘w;弢0IhK[L2tćAݻ1ɾXdȡt^V1Ÿo> /ExtGState << /GS1 12 0 R >> >> endobj 677 0 obj << /Length 3681 /Filter /FlateDecode >> stream HWr۸}~:36/Tlfq;LHHĚ$)[;sPl ܋{=7Q"v>[,ɣ Âii,;{m >-. C|Ɏ:3BO˚}=|Ē3724GWgYEnC/2J"v˨Xж0XC\^Vn˟AtF;\AnCBn󂽒^[QNwe-0"5c$Dآ0,$F3^Q!{ sո L;Pn;6|E̷ Mvf%G E lqcrG+tȢj`1+?&.@t h ?gPE%bV;`t"##2W4 d טtͷHrՈ#8 eoﰳΗ$Ѷ7 :(Ti: "_sF"uui1mz4Z^yCNÕc}brb"KJYC LH}kzHa%NqZv>/eA2I8nGOq~uO{ɮZTkь vG"9hȸ,^&Ul,$"Yȍ.຿Fx^7_f?Ԧ['i6T?E̲#k<q֗jpyD%3,MCQ#5zp&tMÉA+JXp˻x"nڿH厴[ё‘0VdAkQKaQk' ,j-ˁ,_u+zkjZN↧&$leި @=`VR?,N+'@7!N;~V7q v5 rbb6* LKK&7t.(9ȿPF?mlx{=Q"1a'-?=vbko;r'ɵ7tŻ6@qƝlۑ?o':`7>88;}|Kbq }AGrh213բWf? 5PJ Ϭfy9,&A>`ڳn?H`f=.5jAR&zg4y''^(0iJX 6b Ԏnvh-\)lR{fb<EWQzq24X@xz@a;7\FZFM^JAZ ^Pȿ^\6D}!WoIm1WrA?+ r<׷Q~i|IeX'V[YKrÛ-f;0O !!Gy*b&_(EO$J\Rɿ OpI'”s&>~v3^-mQ ,p1۴RRc< +{gxa`f<Β<1LB\;;83VJOaPZis>{<t?YᝎL;&#E.t2}^8*@~*:ŝFs?jNgOc ƤU),梽PqThvqP'ko#@`<oO5yYKz DMQ%WlN6bM#o/%EGm뿖ź n51Wp7G="3Am:!{(j e8EjUkK rQc wp< ݮ$KISjQw~@ӕGQKT@VD?H/+&F:pIڃ2 oM/w8]x ٛ+{7v$5 QCE|WG˛D:[B20Q`Hfz3M՚< ?Ɋ6@!J~V%(j'F;9?PiK-=7%ЍC.u'ޓ6E} ƵF<9V.kjB_2:Å!p 1A@&ht" <=|c[׺Pn ƘCm/Ԝ) V9?26i?Hkz[̯`#$zyYo0o%Оxef1sƹ0 8O#N"7z i;巢HOMF !A_~}_{v+_hY')\x41TZRXkgؒIӈ9* -9Df.7H .E'=騩vlMlI{5甁8\펰?#N)\Ci2߿ mGg+'T6c0T^ꁧ]l 4t%a,YD5̆-Q ;6-\$ ȘO^ g#7*9Uջ:8 endstream endobj 678 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 680 0 obj << /Length 3001 /Filter /FlateDecode >> stream HWr8-E$yrl'd֖_ $xrwkgO"L*T6AO>x<{:XĖ볂WyQ|0es=|sM'" 0r}g. +g1]hva :p^ Ԛm3x[Z*޵F0ղxQG^x@]myۊ-5o;i˖݊ڼps_oGUۈzq\A_ŖA%[l0_e[Et[Ҽۊ(3K] ٲkY"}jЀL'̃]"MMU+hA+"~uSqv+ ZneǴuf#:dW1Ji(+*I#V_ؓ @l޿^&1 kFc" h;C=z@'z"Tx&,)@-bע@2V_ vZ8[iQo6 d^Z1)8n8E˞:X竚(^Vӌh5c 7,0.83j>C+ѣTO4Ldv!LQJKRRl*m'RMؑJ1 Td գln} ݂&0;EmHyעFWfh-8>[>S-jVOat>{Z0"M, sZ4o- {ٝ%*{kv;*e!{&k]`$ Ib# SJM?^r.` gR?й쮧֙ L4=j0L評={+ ࿽HҠHdΝj ʎ m S&}A\&B#P%HNف`ՠZuB?b3O#&lw"A&bA}Y|hX*ϣBվK{SzF҂YGEk1cL\$ 7A`ff($ D%iXGexg~ }Q! 3!ZBiV>'BR5lɶ:Aށ`- Rz3jFaaW53ytesHd~QOğlri:> Dm0BA{A{k?sfDylj􏤉7)T l,q,+Pa@{X׀JFXX) ef,nA~`lOx|/*Hy'74}@809lgFfԡS)ɣ/Ty"ElF f6;5fS / 뿵HC`Nv\XT֭F8xIlEInדܣk53lVF;_ %tT*CN(ĩQp[6o`!+N'\WEB QWpFG@&}(#B1zE=L~G'hjGgt2zA织7fLQ>!Ij]@>h~30i%*DuR ܟs`O4pL_ҸYw^rS" rą)-ɚjn1ӅQ୨w& [VY+t&ՀV19J ;΃b>OǤ<6Ӌ`1'<+Qw^??Q]$W&j{#Ϳ![*4w: p [jH!B=!#!CCwn'(eg,_g;t0z.M0bR eH |zQ,GǮ⋏m롧j/؇d.kUZq|Fc;M2yr"NhDSBVJjѕek5ixX*TxuUgivd8M" t@nsgWdK5|R-Ilc :&QvVv[{8_TsO{*]U4^ŧ_ lo救)!ۨ} N[x*ڞg/W$h8}j/hA <Êo 2.'BjQ_Qݮj/޵ ]KQ쮧:(Iϧ"V.b|دcF;EŮ1;d<{Ҏ-/kj^ @z1M> ph~ߙ]D,l[~> -]#Y^-0&AxYHc`㪛AiM9cW y'ŀA"@f_0i8ݰ  FI6BMЍNS$yq]JA .j#-]x)!p'[D`x&E<!ACFrtas}A۸vB+sP:ZEPa"$߈4 ce**ܢ54[w9ԘGv. s0σ=u3S֚H3Uٕw.ZpU0ȣ'M 3`Pܪb(sX ]~ 082N endstream endobj 681 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 683 0 obj << /Length 3327 /Filter /FlateDecode >> stream HWn}ڀ5sxESE5CILfZrF}n$GHI,L~sի(d{^]U,K(dEZaZ칻 a>_)bk :m ,[1y_u/ᬸeOQHG+R KqEV}0#toqx?ϨӠzENs\N|pD'wh{m$-OԬgտfw=9/ju(q)cl Il{y0|GڜaqO3ei"R3skilV/A/-͆[-$g ov'0/'- XO4Hnïή LF=yYz+ F`AR {!ܴ[D/ۃQyR#/#?/#  |W4W-Xo&eG{͆N zS ϋ9]%[-z $jmEj גI$!W"bg 3ۻ_9GQ-% .[A4HrTE<&KwJwckq;3ͤ(y_ Tg@TQV6L3s@NK7\ fb cQ\Ed$ۥRey4z$?H#SC[Ϳ&AeG]ۇi={58u aF)!6>L XJ 1걀4 3OmY7X! H=Y܂!ϖ#(4#ѤJ|)[/ ~!%n)=&վ$[ f+`ggxKW*l)@)jAN$.`=Hohagv:`IQ@2qcI[b4!(<.4VMqC6R'= Nc]jL RAiوz=QZ LS|3z-q7uF}CNȇ~t~TeKK-,"I«%M w12-YDb%b#eǴf>>3WCI4Ն0q8X_} 12+C] g*IL8O|efԣ^7-%9|WO=jչ=wJ䶛g*a:\FpgcY>b\wh;8;.ވ a.Y]C?i Y5CRgE2{4}8},U>XjksIAxNUɞ[m`Ԙ 'C=a쇻 { !&S2%pe͐r]#.pYʲTgE'*#km\.Fli7"僾gtbB"O#fc@AdғY2w~)M E ';"+pʜgbsB@ 5Oqi endstream endobj 684 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 686 0 obj << /Length 3280 /Filter /FlateDecode >> stream HWr8*]Ҿ9qg\f$$d#vkgOK2S[IK }N~x.X9 gyEI¦,H8e"g{x>bkoUa2SX|#3tś˯}jx#Zv4]ˋθ7RB̒8aWQ0OZvay׫(:e_t5ZV}TzWr-آʬp5N6`VƷű_iD<ǝU< ,^69/747WRkxgnb(\ dɔ E,ʬ\ג" Qp6=s(v;lbiw2ʃ,9I'. ݖoY+ :gö́>TʲpC#ZqĎ5 6dkg:QқtG07ddsNL'gl"&CYLQGp{&.1N m8Xb( <\X{V/0!|2kȆVF7p:0\n{ g39[f(+ES_*=j1r+q9XA5]rusbO*y$.{C+GU 'QMtŇQ Ax>ѺbRXB<C:g0f|j:T0$} ,z⟋QvqS*غA/!"2o Ԋ5wy]X-p ^0ȣ4.s /wݚ}gnꦯ@W@_ JzȲގҎH{ zVSSi>b]"LoMX%`2qw):듅 G_5(a?d ֡' ̏␅9i'ythW r? I,$<':Zպgz;ec0ý_L MА ҇"B"tMC M:bp ΀J;RWqGO]QQ7n+srdz~ԺmǶ&ۧZ^JsV!YO鎭tĚoģP+W cG2N/S`_|ñ;|Hy ~#IbjM;k>`}FOsG/&y*  ?q~;يZ RԴ4,[Jvc㗇pzЂki͎V #U{+q+D0,0>ӄx KQ}ߺ༹iYxk'VC5&͋ (jTjU[j;왱VR{޵@Qihjz(Bl:D݌}?T[I'F=Qg$еd17]=uWgAC\בka1&8KE2%߾5$CLQ+,JϢ 4]nk'Ɨ7!-6@*E&}FJ0J l/ޱbc C(qY5LEju \)֭vB@c8KQsОl;QWf9CGkUE1HGRV8ǒ Z`Jt?I:蚏N3_c%Oq'Ƣ 'visƒ"}x{pYx:)];\>E@1G.dz@\iػD+^c*dcWˎ0Yb.H*60@RZY]ÿr5zn'BR/ٷmK 8|D{ٺnhT7`[=Ad<:6tYA f/4:ԋs`F|'`ZOa{R&okuɌt0a6<݈ X,h1'%9ITx/=\b_=EQ[(?ִs[k͞;=\ϓ72L;4egS H4cc$`gϳڵ\Y$\xdI5>Lm]qGYX%w"f Rg0Z`ܫU[-I"/1ZЩ> /ExtGState << /GS1 12 0 R >> >> endobj 689 0 obj << /Length 1902 /Filter /FlateDecode >> stream HWے۸<$w~I͎8uʵ#yHH$82ONDMe$4ݧOn}y:YY^Ϗm_vf[ܬ}}\?ޕO-feC#zЂE>~j|"3l<s{agp}ysi bwF alxyI̷>~,{Uע0m+!{ kcîj3qݻAj?&ګ (=ZglՑfA%z;0ۿ9͈I{qЀIKh!9{3*W^g%V>^Ksr{AEI`1bLՍ!IvkO9*M"i8H&د%.Hvt0JBO 1Ma* pqrj̥wJfG xttI9,ZEh A]!O&CCj,q5"- :;-K* !EĒr;ۃzĮFE1R͉z7`| endstream endobj 690 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 692 0 obj << /Length 4663 /Filter /FlateDecode >> stream HWr<)qɛfػ[T!0'0\ YI&T'{ Hˎ2Ig^^|CH.J_)" $-EEnm{o7aa"n+vxqeًۿQЅ ~OTk~'ǯU ݉Wcz^Y%jO6Amr8 cAoLD?~OѾ(v"7AJEe⊡7N(8,>yWҳY4?JT6ȷ3% 6I8l)\էxPt#H=t+³.C/ȉEro5Z ځaP̳>%B>?}8WL 1><(yt5>%ԋE&'˴P>/ X5mC nqd0.dNl"DVacnҰ\R_Q$pگƦ U,;T;Rr@1sSHKB UGU;"\ҚW %B^tO#*thֵARr/pc,+s+Jn8j5ФA9NQ wD,3 ; t6m3:httBa\։%QQ,54hq ~ė?6Ђ%bVHHU~-Y A;, U $EIL9KWvl]oe.tnpm-y!Z={0rn>7A慿 -I*q(tC;3;/Ro=fP&ryg<ޝtC\|:X~ܠ/5t%8Mώf-WmJLKb4Ѯz ytf xf!.|"8:cfe5ʹ}G._l ?sy{HCQ-vVͦw5Ă,3 +}N' '% }dVpvW݅($8Γ<Po:[]$Pr 2dnmL ?:T-?jopкYhon<' cI#h;3y5n@ My8vtIzQ葉l_DIw=0]nIjk: e4Y/(f DWOD-qLX١l@x<zTp"^kI$T!t ǧrns˥dV 1܃ɏMSȒ0P+Mz_؜s]sEC(]y' nZ[CH9A8t3/TT"H~&|f,m_BlM*!{c EzCe@dBƸhVQNdPLƽh~l5*(rg>zGI_g1 yKol?czGbqb@ P! ddUܰE5z?hVLi>FI--uNI@whoԅ|gozY\YUdP,OXzTPD!/YI˴ /]0WTG;z<7vEcIvќ.bK(qF*U"|5_ 8NbR|Bfkڅ+ro :˖jz4iU|pԼB8^3'+M4L y"4E9TŸ-4IGur+%>o:vaZ'm&zÞha[oQzpئ88])=鮸xpGd@ԑm@V%3*\B$+>&|v{:$@vC C á1i!jE ޹yD*+;~]3)|^oϗ~rtvr)ބhfo7j?>_TSa~o,{HՊâ`U`%s.My1}q6! aޱN'O]e;<,`.В#\ܔRr"F̔ sl^?[',d@ 7QXMzlWcjC:`&XΞD? N{?JC@䳫ޣ~T躋g6mqt(Avx"9SsN |7_%נD ?sǯhpw0e>mnKpcehD*ɷ۟j 02Q7_(:TFG}5 endstream endobj 693 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 695 0 obj << /Length 4811 /Filter /FlateDecode >> stream HWɒ:́r6.[KcPsFEH @sO˪PH ˗/3߬^B*c!d,YF"Wl0]l]]Lj_p]'jax*5ժn+aWQ n=Ko2Z(jl@Z!g.)Dȝ-:>WUJ_<?#( IXvFyk7Tɢh*~j?]~/kZ SĐW^ b4wؕ³T7B树RlI@G#8K?#!,A׹8^m}8C_EiJnmiBPrb ?)ph+ޫPEYLZ4Y{un(b$fn'!-{_",؁t<5l gcO]A3mƽUJsˤ-R΍ض%$RE0 VBdH;8h)k̉3rS6_E ݒ B9북* 4`Iء' #}H։4GF±X1{i{M( Π 7; ׾0;0 [x"кO / IfN@6cf҈\͂n27;g腢{]w!=@Ϩq=eIVM.RXN-jn^~fp'P`Ѕu߉*F*8kZVrhJJ` UDS',C7!,Kߵ^@MxN,(]# yʩGT@.,vqz bD@7b嵯~](L=.lRqB0ܯ;K fg~!=f!*vLAm!JI>f 緯|jUz- 5OB#BKvЛV5Z;11[Iǻ+YWr"!V^p#' ]h*N/nAtv6G Z>)5XQih]"܋^W6p/H05c0qk^=r5XfwS;CmU=fBa7)e#D' 6-6IϒPǗ ݕ3 A̽~E $hqaF|#7;n% -诽bILLrP){7x]{9%GQ)د-}]bMmC ;=ݫ =_ƹw J>d{}8֟[} P8cC jI/Z?ADםh!42݅O%e92rYL\~~Yub 8':7rK{{8KVyb-<[w?,?_,bxOp)-TnCa%q*~Ll)h񨪱/NT7UJuf {7?)YT}D:Z"Իe6H7ͥhoo \Se@TVӦU"=ɝƤMo:H5 \=u`w~CѪ$r헟)&Ul.C m96WY_1Jw nEݗqW`<k.῜Wێ~#Zk8x7 -%+e69~!r/dF26; 4X]]uSւ(٢jgEClЄ:7l$JT&vg~6/@yo8vn}CXC)mA8ڔsعu'7 ?)Cp5 R>Տ ym1a{׏qԠث|Q8ػY"> d݂Ϳ I9۶Mn(}>, S,ag![G؅{…PS΢*|lv![?V\T"[!+VGdJ1կRϰOY=9^!M0LJo?>T:`CzjUN(MiKwIE & D3 H 2 '[;֕ z7Ygx`;r^ 'tCW"J"iYҪ83^QQsღOKv9xV+ Ƕ^ߵJ6"H^+r9 (U !UYVgR]1}S|h RCa云(Kj8-GZt#ǣOW#0z.# "cjtEK=WOf6'v[Ba=úŶr ϺӨ8bI(x! k8V ۼK#Wa6E-HO"(ȑ>; *FPH͓46d[Ab[Fu_Z5قOD4OWr&fc`rryef<#G,:L/F)ʏ&p:(Laxx !R43gzGsjY #^O Z2VJ\-IGP5gƴ@L;)nɵ# 3*PY~e3y^‚5EXk- v$~~TB<7]ngI̅rt4 !HQi0B% NW0UQ\Ʃ9 mS|63`*EgݨܞDeT_pF7ǖn'±ϕ"|겥+RXj0 Cs;lԘ.O -E>̽" 'X@Np iLˇqbɞWT>5Nͅyi&ֿOqkf̩;0b'*c,npjeR|X\ z6^PӋC5gPtLrZgB)ZgƑ{>ldme%j/f<-q@a#5N@ǽJ=|E1wU*kͬVoA #-B+4v@rl&Ź=ׄ/iưv2X @AO u±ڸv oUփ\]Me ٯ^t4WcWH8{6R'bTT֣̾o!߃_ZqFTnK~ r endstream endobj 696 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 698 0 obj << /Length 4927 /Filter /FlateDecode >> stream HWےPsE|TBªNuZ6HUՄcJuS5m.}c=iuF_uvI[J'[!j7V8: 5DONM8^r-OV>^ϧ\qPmBJuF)u\(_ Wp4A@M_O3Do1U4J3ǐ/9#XmN->W}u>5Ðz$.a0ӛOm0,dv΃T뛚ylFS֏3!r!갦_yjU楏^[㴹drt13ANG5v'w c&sa98d$u#8v{zjp 7XaD}x!RC`w6=q੝鴲㾉E1]V6(x<\ jo{{~$feQjJ̅9sLi^8<(oT,ek0X,1 ֊$=!I)H6.IoJs*C䊆g%ik% | O. ث֠ZVb`xK0`%lڶb F@UƵ88,ou?b%]Fikf\awyfu)H0D P=XZ$H<ʵKfGI%˥ôzjk{T6{es'd8*'mn!y>Ohrs#| Z G O C b$rFg5 >SP^em͕ F]31SBWO-9[[ڢb鍴9 F+Udo6ҏ>06 |꣣eySR=}w>Ѐ >PEK5_-zjMh %|@ݘΗ$f0uåwzP!gwAeͧ*z»[ e6-?MP!/~0fbovR:׿2[I+jSU&~0g2mA𓽼Ov^n Ao?##FwvPȔγXxےsǽ h+FmEN]q?GfCizsi\$輈9D딲{0PˀH$h3M @]PicP$v*~a;|a97xHO=9NFq5 w彵OJ_u2E4yU p^KvBigY XެMnf×K_Y(dTph7M7)HCALͳxj_S3 C!mogYfص L*i힚z;s "PECDZIM 6`xg z՜x%<\rӥXZV j'ӋwV|Pdzև3^>ucOv +KЏ׎[/^@gy>tŪF_uͮeخk8V{NЌ{xMjgxg>/-x] %0Iߟ"PZFa. 3\gװo`YmIz)9޶uhb~P@*P8h4|2XWrF* vO։JH:sC1aB,0 V"ʒňO}`yRkLbhe;{\OR,YgFJn}A`!cJȷn7238p0rmYbP&|)79kGGwi Oʫ̄̄g`,Ww g Rr{<1H,ri"FYm3#xh@"?[d,] % c-hKXE_tFG9޵y;<ʾzSӥNEUe/-aY` H 1T_TqZI }8ǡdإp]+$o5,kߌ`jI#ot# ѕ_c4N=.DeYlVc~yhGpR 40 )eah)S-ZlY_mfܨWݽy%RZVɸÔxt| 3L//Hb 2ԐATYݯ)b3!Q, y;>\ @v|Go6{uf>z0p|>SZp:+me# ;g i)mjktmMfgN48=;^Ȳv04XW7r`5&}UͱkQ*$Ղ_ؠᒍ=j:7惜|~+TJ*N+G~5zZN:M虹ڱÅq9y萘!cKCq9E1*cER("w<΢/"ԘA#lVar;@Apئ+v;,񯏷pzF⌻ʪ܈Dfl46̦l6   XʕB^UxBZ`"Es?穫D)QdjIjTT+[u8`0{E9 ◤. ٹ0.]&6n]<Wag cg=;NjU%HZ i^ 36hj7$!ڔEnD{ĿG@.EFrPpȺl+ESLWL+=̔o}̤Cɢ<ᒮ6L¦>nEk.~;(Oh:SK-*j:-&&ԣ6Y[@ͥAjlj:v.nt_4t k"4efl@+hdAH(w$3ĚF,;O}6AFsC[H)cVΊJq!9e>Pb:3rʢA`-Q ] vvt{2xapڏnID!3ٛ`@N, 6EsFgVO26+FOf@n5lY0tύˌvm1:vcH`+ޙfweQA_Lػ 0Ve endstream endobj 699 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 701 0 obj << /Length 3232 /Filter /FlateDecode >> stream HW}}U H?mNHШ5n8^T8z};3$ҮHZ~{wo? ٶYrgFemwc[ l;/ w'B1ٰm߄+*pO,ް7ۯ94܏u߲0~f)B?7 =F˶v:gx/7>VRS".M8HB7ЦpچGOQoRck/pb= Ϳ󢵟iDEA'0uH`gmڞfS4H_1~l~kZg P>E0OɁ޶L gj8ڮBUNIgO t 3%Up&NAnaZc+!;|(g#lкNbe[mYL (1^,gȕ^y0oO5< FfmsI = r/|{ R@eŞ^ҳƸgM ı0bl:,8\-$& ^D1,5A"4\u 4[>h $DJNTlgWL|;BYkrtS]N-Z#}jX;t;B$3mK;QV]'j z+Fo63fE? Bѡ~Zir*('}t$;0&Of ܋B*=,G[QvMJ9P ᐫJ^ { }䪭\|E]íS⛂7%i܀o z~$ ]5 VS^Ot!N+k` ׹־EڞzNmx"F}5<67*ό9PC'Eք=ܻABhfyrTK}yi&ls8ª@mش ~5`Ob^5V2*>_c OW>{a)" f0qCP'h IkE=Xb|tvJfA(cNNxz:@yMKЊuEy:R.nī(݅Y 1Z׎m;W/ͱů7l1|vB@r\&7SN,+qX'ev1(sF8@99q "OtM魑HÊk 7^Q6Ԏ-|{#}L35p& z(C1^)43Sjq 7ׇ:zp8+eYuv,Y ;Zd 9B'3P$bӄ0ڣO1Ԟqt+s(eTT0Re:Wa4JL ;J?󛕞3G9kY\0Ҙac߰ޯ#S ..WI "kA;LW:;=3m:456õiBU0wrDaS~pJsLpY3}3~:A~A#h*i$gw zHrQ]DivRh۽-#= I, ,&9rSh#I8$r |QF"%(޿x*g}jϟ+Smo'9W/||h:C3i#Yp+N'|< '-Q\-WYqyU{"pYbeCyz{]gkEW^xP=˞ٷaAZ las?˃HJiYP4GRCC;>jRPnKgv˒TPFo%F_AEDq:1AΕh[fbLk> VNQ+6!7 tvtzMJ5d}JŤf Bӝ_2Sf+)|zg%e݀ZYVKl4(xNoiOCw4*ޘFtWukSM=xW7Y`{雙C;(fͲl;Bzղ=tT]ôpXpWbݮ{>jWG''3obwឬ> /ExtGState << /GS1 12 0 R >> >> endobj 706 0 obj << /Length 4418 /Filter /FlateDecode >> stream HWے۸tOElX$bia&"xmMaUgmTV\4IJzY5}9ɎVg_wylqVvT,  ?IpcYfQŊ Ja֔Aj_qadzwo?}7zw'A‹霷)vY~/II~ҝ3|QQTelvlrD/]ohV6gv ]'Zvw8;f{_ݖ}Z'-iPeQUTcE my#ToU4*1@μFXkw_<^KsfjV; v;vI6)ϱCX,Ϫ,|;ej$ed)j= <JKܲ^lsJv8 0}E=꟫_oQ+ lAc_JAlOicC;ԂEgDoP+KN G!CnhW0@m zdne ۫;q h[/j854~8IxϿi#}^p- S('@!by#tV;H Z9L#˞&=J0@IЮ 9t{njJwH=VB˚|CO%$  r q[:OY fQׂrHQ0~8}ܿH>GILBSXde}*+/\nAFCkAV Z]%~L ڲS msN CAH}7jlku՞m%ީVmJըtеhT~5`ICd] vLl ĠLeD,@kK]H?Bz+VmdԮv"wbi2 ,F} e«!׹Gfplik VCgz G݊Xc-u]6`O3yάnfzـxPfY&y2i!V)CXt6!bVHd5M3m2,PO x[4Q5J=27˾cn~$6@3/ nC5~ /ȢguՌ d;2;zmV!2@Cm7qPٰH?H&/F29zX[%G o6@܉h?vSId /3AuIgp).ЖU5bll.-G6-5a~n$V5$w7J+:@R|G77ظ]icd%aCav\_eQ#jYts?܊`KVm{ǦAŶ,m*hQd'pC( vfқ݀/9(r7Q; j*PX=0rSon̈ImgZe n85xB!K)'[?zrc/׳s=Z\ Kv;Z ۏ[шlf7\ao'"ʴ ,Ѕ򷜢;Zs%9N27\KMyvwmf6T_cϜ׉7p)#Ԏp9(f hH1 trJ'!*?yôb۝x5jvґmh~꺒r90Y/ ?v[wYwtɎ kxvF.[$p f"8N}G(2bARQsl hc'qٷWտW}ּuu,d{Π'G촾Fw0'zfFIqL)}ljg9^F1n݂}l!oR[tˏ5 J7°z Q;Y/?qQjm¿`ü RbIǠj(*B-Z^_R¯;qڮ6s̹|ttQ$ܜc] 8jcĚN)hS'%`O<{xM{3$}Yj5dh]Va\usAY jth[O]5&}^= ǕV'LY|fE0rs>.jlp?;=b~E o +'5s]^ܫ:)s&E ]D#5;OxX?l08y$bI2䦺vc][bT oY/b;>V*51=L ٛ^HZbri`pW++X ĿRԐj"{VX1i(1+:i+ˣԕ)$F /i!F1q}QR*ngG->+4oaԨxxw)9DҢSŎr,B*?÷!ob`uoH@ޕ8ȻzHbͥH!8~K!+.K)(g6t)'^ 24N : ,4#3`0!J1͘ s曬%CɊćp.0k &G=kmm}X/Yg-.c?yn{--gX}ikBbE7 3m[|nȃ弫]'xYNmx)AB;)R);8Irl) -T_#T;4 e)+8֔t:x=;4~E q)َQFk Aob|iCrB1*MY˩Q\l ; FN~ aF!aMA DO7ڥuo[y~T4z45T75;Z'R2dvC`ֲ_* Yo\MB@ C ( e*TGz.[PZZѥT0 `Zv{ Fu;F1C?ͦ*9e Z_@ljPTnJ!cよ?d.ʄm/҉ۚזw+W&g"A֗','>+֍OkÔ4ʦ<#s۱b};LbЬ%|Ю YJ=uH Q^AhEBҲ:SYff\)|a2m t5Ǐ3*%WR@msq+vAM@1+LnBA[ /ꚥG<\ - x֑L2Bv: btx'tɍ5B8 ?߷Uyg0G3MQ;9Fv?u@4PthYntģ#2| ѧ endstream endobj 707 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 709 0 obj << /Length 4874 /Filter /FlateDecode >> stream HWrüN0w8Oڊ*+F$V Ds?3I RΜKw7W?qqH)cD8H7=^G.^lU~pub,:5궢aYo쯲Ÿ޾d/WܜSNj^^1s@d~_ 8b < 19ogu˪\ndUN<&[#Yxa`[ZV;s)Gt3uղ7R)fWM{Ԛg\Vٜ}M. :?1olk.v-ul oݾ#;Uكڣ ]aW4s^7> b/,pum?ԬV1yo;p)Ztt }uQ-o#3 ?'Ipe!B sY[:칺 *C/,EnH:xhj;XHl0 Qu@93vC "4#Ecԣ EN/]?h5szx>BᔑZea:5Bǧhd}jd"a>ld@(b́`҈ϛ,RJLg,NiVX8̺S"fȼkH!LggI؈"S Q"=2@Dڭif5ڶȠGE#wJ#M]߽RLqzpAiwV`2DŐc|_$:vC-vix8:y AX(gQ#(%v!J,u*~n4m@$uBMIIsH$;K>9-`W2F͠հnjPz/k#ˁ)5Eqݮcۗqdbޡ3ڎN Oǜ|a:)rwP9\ 0kL!N;\)tW"*JRv(AQx <$NAS٨}k(5'TպwY5lgʚ(E YӖzUn֭p'>\Vıkgkq(+ZRJFی +@4}%~%t4r*I+7&S)H2CTv1W/=n:*wduаfux*_K ]AjEOl-έM2E,JhicpՍ\odݑZ*`)7EdP<YpƯ'vluDˍ*w L-~!u"WV3oLAq[<0\`NLAŮ,GynRښzۣ%)7 |M: Le<9&IƑԲQ:e0a@bkInM:zwhI$` @-ݐ3;ˎ(iB7 cm [Sת!Mh *%hԩ,,oFzԛd#:FoAզk;&5/x uXzdI$; (LIG c  {;fWU虹zkDBηaء{Z7T5aO<6C.2hC5ۃ{M~:rA`%Sn&Dl-ۊ#VRhtAZ.s.]L_G0.&Q64 wnf7mq"ŵA{|x2',VLg! Icx%un49h&{bynwЂxdRsLpFnLviu}U0o`J̨u<۪浄0QG-Ju&Ta5k9*w`K%yPSz\9@bx?hZ]!eilFXҾBVS~a-Q$1^)"Hڂ%vP4 U+f%00z5(jtUG.NjߤfrZ=|' gs^qyaye.Le!.gi1ݲ7<"_yHXLlǐ[ iǝJΖI vnӈp,/#4"j nٔ42|3Uaސze ,5 OMNBęOf/W^ݳz96uW,kz.kɐX+ 1XW納KR/ͻFCBa*\oǪ8V?mlFェ}A^[-sWMy;^z_΂ endstream endobj 710 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 712 0 obj << /Length 4704 /Filter /FlateDecode >> stream HWr<  .[.Waȉ v|VON$@ڱtWwgn,c>e,ʼeX$JF:==cg>^~:;=cw$zaxFh.ux]kUUBR9d]]]6V<߰VJ0afT=ӼT5/ܹy-8e"sEpiaW\?lE 3-Ru岮UpUc7'7YYFUnay5_e:CR@9Pε-=L ӕS-֓,y uCPA [ uhZ`)؆(( ]Xν((YZ'88#UFjNH@iAHd!Ȩo4ҽ$v(wBXWm4]Ś _; $mx$ H9dM J[/;#H$gJgPf#?I-kJ bfSygdζ(׌B˝9E)VZ; ӑ\U [tJ@ߑkT6\Y?aM6|+eZu,FY\+MOj " 8oDg~U DR02k@ضm+ۮ&n{=ZP{ey0NlxiUӒon 6LMMhCtr: '*{ɗXj~*=V~3pGmezy{A!f/'VMSVJ"1WBר+{O Ys]\jP:ȲŌM /]G9ue|dHGBdڴșY鲠ھm }7®(@!k6 K墇ߣpɨ7h*]u%Ml^8?_9$ɉEJup#h%MAѿ9\&Bm?ƫ=֝Afi<ghmL1ߏϓ5cwvLs<5zIG75|TH Zg;Ά785o|4dy{7$4qa`b/Ed F~ns%Rbw,ax I;@hTڹJ;Dk(;}vVm`yEԍxu 䃐$'$bˈl®T[G2P`=xǍ*7PxNIT!9kwpk޴}_2oPChVUZ (s=39tW ﯔIgen>8!mW;=EZ V_z y2]D?)k%8I#lV;&jΑ%)Ƙ=^俹H,NJcjBUt*pc(eH,9DNF;u]ոW7v4h5k:o1.uDrdhI݅%PQ[}K#I&_M\դ v1^-;I  m]ؽ'HEV_G>,J@ʌ'4+0Fy)Y,>یwH,xe9"u-Ȕ8K$ {ĬQ(YK4 (W& RГZ̰[sMf /6lxUSB 񶈸Ryȍy1I'¹]2ViRvBA@]Dl[rE e N Q$jzOצ.|W@Ӏ$ b^XǠrhqD_573ݯ6E4=^K?!bEMgRW~BŰ([&MS( !s (ĥiFvÔzT`R&E%‹,hG&ZYFj1 k@5'uՙ(,jXkq&}|i]vBUK8XM tG®{])B(gXU΂Z C|DVF6x)r0K.e;7 #Dw-7:*.=FD"8`&𒛛%9(bJ-w_ixw O,VTT;b-TQ4\Bn2{K;;ؽṳmh gJO dۑLnX fvtmUiSt#hqSCO/"e`h%W=C"Ft-k Z}qs> ]o%Ag%3vVl?ҡ!M&6Idim@18מ`9zw9wt!uh Wq }j}Ts.4%@G b;# A*:Oځ"c6̉Es/ ])D;PxRWK0C 8Vl@![X]H:l28QU{X[3)B֨i~^̿6xj8kO zK4BWʕѮhݘPe+st'vgT(ٌx ڢ=yRVk.''W :V:3@ʃuo\G//V+{o&V?p 3@  {d⽤\kzlGpBDxg*0 UʌMuJYK{Y*[kMa&<k0\ߚ 5fH^]=;%uQdSv K3YEOVqi024j ,l0ئcm~.;O7K)/u2,be|d3/UFO`fεM\T΍s% / ^`;7D endstream endobj 713 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 715 0 obj << /Length 1013 /Filter /FlateDecode >> stream HUr6> x_:/I8d Bj`ȊO Vw<س{كw5`8*_QH8'4BFd4:}?e0ˬM(h|^=d1 \|YDt~'?2YA,`v9ˢ@}$$iR;摣#JZ%?XKZKVxJMuuCJCWV> C]!5IH"wM11~B;\3u!g~"l/Wl:V$i {rZֵܱ ex3b_d$Z+KiVUh+ 6j.5w|%P)O콪k?짾Rm~@/u}~|%LЉ;k,",Ϸ咋HI$>h"N0ж8#]!!=VM פ~QkY`3,FhFlq\*w' }}| nT! L]s+*z}MV,%R{tGpiЍk9Fi2IЌq)>*u4&tp_e~Uoê6 -&[dwq ~Skܗ;,B͍IJE(pZBf?OyDžբ W2#Y$}]]@g7-Q+Yת¸vp+܇go鸈#&h˒WbS}/N1o9Ba~I+98klJ8OY8N\ݯ(*j,[5le/Z.c\o<{x3h574;^ԢS`kl]{έ־]xSc@K Xun姊I"_7Ds5+xw\ endstream endobj 716 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 718 0 obj << /Length 4838 /Filter /FlateDecode >> stream HWY=ܡ~1t`Z/Q#jd8L @izH_V hr;ח/_~Gc[oo2_4p X;Fl]ݸ7=|c;}:lKW_ɜkya?3͝y'4G^B3Y7MJ(QhU'CQϷ#'%~Yd:yq_<{ٙ8p(LV)Nmv,_cmT[ԯO͉I֊z+k隵{t={&^% ^d#ӼRTn |%ZuI8bqq6/'kaů^OQ-3k_f~8^;M @G|3Ϗ_a cNf1#@2FVbz/Z&L|; Njan(Qgl\PhI^Q,KӋ1 !C;k|"gv@):^yah(ls&뿚}kj =#yӝQ0 דlԨt-Snۄɴ/ŶJxoJAɛ(QF.x]Y1JҢ< /{ {FI9,d-J=h/Lƴba(;(Y@dgй-ө`Z%kE]1u/{ 6yi(\Q]E[Z}o&k*~FNLA e$ZVxnvj ȷ4ǔ4[b&">O}}uX@6\Wgε`'-ld`!9HfI3hُJRT宥(i[Ⱥ,ybj,Qh\Cvh{㼉A Z׃<4Fs;E̲0_!^ S4 TF^Gb*nL r%8Jϟ5)2;DfҌvWEĄi҉lVW V0ɨ7P%G i4'y?P0\`3To,гGTa%NFكW~_:-%-Lo̟&Px7w)%r#;DF]!TpCZ$rhNi0%F6}yX `~kV(y>-YE[u7j;?g%W;}iWTycc֦pqn%2`f\O]nE}{y^ުÞ #D>SFY(t2ۈ!jjlO|kJ<6 ~-dcض1=?kmb{ ,i@4]wX]75/&'m3Od`gPQ ȻZ!u\E&zJؚuĈ/ *M8!#p}l޾d},eH`U?,SSU>se֦Dnճ0'N%$҅ifp5K8n##JA%üj,0H%Eep=w a4ޙ%{).LbʒIlulCfI@|<ǡXA:Ú?j)m'f2I0O2Fi&0kr =kdQmN!4n ٫O%aq鰇4&FK\z Sbf-`2R^-9#Gs.O,ڀf`6,UȔ|M񋈤b0]%UfdċoqwT č.wr.Jf"[mbi,˧)X5-Z0Hjo8lx Pj?<=l]7 'jT+ fJ(m!-#C$vF,HDQwSU1k}h7& gJ[yhK ]t ,>LG{`T~o=THB^o銎4'wv ՟C]QD%CҏT!Z"ľ^9>* &=Uz{h~2Jr=^,ɱ (?zS)WJ${ FWD#hGuGT#y&:Ly߿|bq;&0;Fga*KIߟux #BFi#9$EZg`?[OY3}oQZؘ"-x-|OQJ%ELNPYQą<p+Bi\|OʸQBU$qDiR}0 B]qsAPCndeFf'!mqhy>I*D^>) G4;.>T ]v鰋QpLRN@|h =蚎2 =0?E~ E$h;1oMj,5N|u-⁻>T 3|ـ oʁmS̝;L7]%;#`K(-A ^~Y,Mh/F(/Y()bK_%9$˲3-8/KCwfx*_Tb(EOlafGel'ӅYYVd*2yar וKX o FHf\JZ9 hل`~wU{Nm^D&>np0j95!Y®m&j o6uJ!Ϧ<E<)r]g_ޫ z.o,8s85䴡$yRL͹Uh+%B%Mkر6> j=Rsi[.YBӡGFnI[:7 FB^<9nGTLJn%Nm['\?#' !sNOToU\h?{WAֽlwX1Y\4vlPY.MS001܀E`~cmn4hM5po2!E_7LЖeEЅUXIY҅,E 6Р_1`yr=F6^Bx-Vf()L\Hg Q FT\yq᷇,CK7Kh/qZƣʢ!<r^]PZ(X%>FNJ5ƭa *4/ 7|p^ ʅol H|s8+;Ƴ(93O΅`|:Y]\Չ^Hp'_ZE 蒔˺ Gb@C`y3zH٠hs"~4n%Oz>|@8}{ ]*PFy_`cݡjf[IK1eG 5qx1`!:.#"|ߞ\RʈW[m̿?#Yb5#ϢJqp*n R]`db1։uםk_46LtuW J|?(I5Pj ԡK*d̄c}ӱ=j:v[1Ŷo0v(._K̓CN8s=#`QslvSG2:dRݰj–-ʖV>?#$XudhNwQ XvuM׎v0VH;~(-.ꪾwE0@;|rnDCմ2ѪQ/_R endstream endobj 719 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 721 0 obj << /Length 4597 /Filter /FlateDecode >> stream HWے<Τ4I]HfoWRIy^0$$C ATC9 j.[)miD6}N>$f {,?[eIMe$c9?@qALZ+(1Uw;=BϜRW{ GiN41^B7gA,5ڟsw$xRؘknMV4(JZu 5TǾ |N>79\(2pJUOwmem$Xly.Fq*MF^G@mO,)4ZPwٳVh=^͒yą=Խ:jضW}KΈ95;-bS]c.'9-qG4vQn՘X-C`=EZ6h.f$Ӱ2VsKT!)V3'=,fHPxiAfW8Q4RoKezsX yN}%돪'|ZzI&i<qḱ:P)} |he)y^:[e&^͟إ:t+jEQ6ġ1gOa-Ԇ\. lnߜl ?jȳwl`$EUO,KR>/8 ?HC(ȅ*&x1bPHaD/?YZ5n2,y2׾|DW3AV&R^'[3}tbcO,{=z~D> JFE7 ,(ʚCi錍;@$4 0)Z˲ ZDݢ%t/&̛%|V \jwDÞW-#P-k~JwL@z4~=ja1LaF'<-o("+0vHdNV< _4?/VrL\gslY:xcR7WHw?l.`FAX7½FSck-{B^Ap;f٨|O&eU^HA!yVn&pԻ:IT>ˎ|Um5ɵ}O3ToN7^΅@a1rFrT1QirgK@4x!~@3Eay,pi4l=S,)-P&1hoVnޔLzКd{2wtc^aI*{`Ifg _قUy<5~:9kLvL'=PkBzeH'>` ws\s Xb`PJU8kZ-G>Tq&;\]^'44 @F.* Ag  {z8um[p}"+S]3 Y:A@GMpYX.k<.{b4+77`YLc/lMtZ*BZEZ%yu) َ]N;uw֑ͧlXhV GїbLmaKbRsCmM]бSgEψz'c_)ALr$q6s1"zm_EIA,du*pGt#V+WvU|5dβ(hi3M8ؿCRf=g,A'Lcn-HINvwGurx$ר~fnһ;"ZoehSl N~ھg~NDE/L}i˅2ÈX*9ao,r_3hnoU428UEh7kwp5X^(c̅`)(ʙ_eDXʹ[NLU(Ep8 |Gk6.JVԴ$F`'_L/!f9[i߅nsuЙũ0xn :i푶mf 8*,S'-[G4ʳ$F@p,'} 5 w3!U`.$ul$_—uaeAd˭Oa. 3J pƊwm)Z0Zm(ߢ[oy!/NSAMdR6sma] _`NR489n΃F>,8@ųU JBcM7X"# 9+O3hv [&LkYZUaG GF/^nrT"⥣ꠚEu ն۶D G .&hp/uJZQ?Egvvy)D-ggmڽqʋ!ɇ Dj>t6U9f*|;w*CE -9zl~kEj4?/0mƬT{(SAbJ3[kV$T.Um)OƁfT* JE{ۋY(PP\g[tR,(<\j!*)uAPoMt>Y)X59H:=hI0A6`/H[6NPMG$A| kȞ#Z4lٱCĦ(k U,z}IUg!Tvbn:.!NXaG:(Ү0|hOP0ӣj: W,.qh39GYƂrM*YDK^v9!.l%ݗSeDsfL:(6x!Md׈nmI\.JUӻxX`4<|dnϪ,KkTR-Zs2+ʤ˦xVm H^p{{ÃhwwS'( ѕІ^:KA/-W~0`:^6) x5?p$~sNc>=T5["xމJAt^> crc"~( i,^4=c NC\%|McUTGSӤEmx ,ʿ$a܋':`RY ж폵+ @z}x}wc]SӵJa?Hヌ<@7N\ʝcZ`17i9/~!_>:pHj*[-u˃}GܳuK X4=p֊0to].Ȏ%Ԇc3Xt6IݲJIy&`YdEyiMV7&sUatLQHY{Fʿ?@:9P0]NIg^5[PK;BԹ Vc` ې]-T!ig,@L"@Kzk Nbs9'[i.[R!^\%ivx;CM(L|{@VEo}3OV<LFh{Ql%QJ{nɑ<{P`ةa(oV@xjNGil{*OE)2k9TEĝT,g,nEC㓂@0Z5JÈ`Zne fibE(گXdޗJ4 ?&TTxe/l$'> /ExtGState << /GS1 12 0 R >> >> endobj 724 0 obj << /Length 3746 /Filter /FlateDecode >> stream HWrܺ&xY~Sl9b!xCZ7JrɕrgIfzzzݜ9lswr~£qGAM}g=5~gA6s{n؈~?DΉk\stvܵ]-z6ؗhTsϔfN4Nv,Y߲mZvwI}**vYZ6fazfIR?yVurɢr-|M>>3;'I&R3kXa{UC'5%6>> &|DU=3w{[RMI݋m)>ϓd?B):٣Ah(ڮ>},;M0c`{LCAU(,9ͣE^ȝ¯^&r\0b)M]ޫNf$jeD˧;U_~J6yn=ߣR rVDmj G?bh$, 1hAs<\YQ U(APJ:aT}jZVp* Tiff_ ݫm۾;FQJ> " M-TӃ;;6> yaG5⃨s_ Mw{l;41UFy2u (P!i,-Qe`Z'LnIˊ FA[Aֳ^Ҡ=} @~(GhX4RSfqydd6|FN[UB?j h$J hT$"H#/L v}aD9ɀ?&OiEDtO+<"{U$jX,xJC3 U'ޔv|p;%*^⼞?ɮ63?AxR YىH.(="bGU" VA0iѾؙHW*/ԡYa_=4 Qdp{nY᧪42yÉt95l؍$qN ݃@5eoPcXu{+W50j9Sv 8?ZL4 X4$WjUsf.t.ҏw?k^>*,ש{l(BT0w\G%ӹ3YpM bĖs-%lj٥8}%5 )1Z}ܰq,[ )}^׼\紎6rʲX[gJS<Ⳛ5ܒ˰׽ˤRLH!&+ﱚ:xf/XkG4٩@j٢#g2Q/0rwLSocmBY7! z5lx1۶Q8REVl̲ U5mhTTEs[#Kŝ.:I3!6AڍHcDz"@{k$ n*థѓu8 P/l4XXo'Xb{?In!sD"n#d:(YIS=0zC՘NWLCqŝ*~q&@* 0j7^ c̘&v -<0L[y'n\ix'{6k:&f_[jFgntPR:7/$Cjx{֗gXdcvKMg_IdoFAhLIRz֣f{'7 x4cTU#S"(H4R2ŬcÄixN.H١#V+MD>q ݥ,S0xk,hx\[ȍ֚n.?_\b%&H_'O3? Єp{`!|"%+ n^ov _+dŮhs݉?ʹ%.K25Zn } 34ѱ]KhL t3/}a5qnw ιqrQ"8sW8; qZ'oU_H,u ;h$TL>4q{{u3ׄ{ܞ_ '5$?]/0/vjۤE2GԿӣEdxHf۷ƭ}-IⓩN׈Lx1)Q_R:x,{r Y|OI0YE5 u:(}W`73q{3xO'IN5XSs0~p!c璿:d 8ܓHIB7ޠ,2|K1ɠIU\ U'q~2c==Z$m/&EvU[1BPਞ$m U װ:M4N%y?嶝F';UW.,:#:5 Nr91L%l+OG48 Ash-ЃhZvoH00T*Lu{zg2c[;4iYȎc?8EoC֩;h4-$|:! pKUD?gʅ@V GQJ̖5JszΑ (V*dH%{_5} 6}O.A~)S y][0ϤQ',WbUh<|'Zfy[zӟ x7A8K{A4 )Abs猄wAPϜ5j4W527GY h'~`kjϼЂz'~ֱ\- ,)mXať9ua q{gF1T҇?Ww[}GQ|i 1}& HΫr8跿Ag@W(J\O)/pL1p=0'U5I`At@1_ZŽ/1_"+ x`OQFo5phڨɼkksY6OS6 mDwt')=CNa\+15CW K‹N!!-ץG/G~-ۈNϿs9[#2%WXq [6b8f <oPz0P$)ɟoNR-ȯd=l5|o1{xeߓ /$'d]{>q9B=T]Z;D? o 3{3d$mwžNԉC Q@ˉ جڡ4ުvA9˵99d?MmKf8ؽ(J0`(ֶ|y˿ endstream endobj 725 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 727 0 obj << /Length 4445 /Filter /FlateDecode >> stream HWrIYW^EWyw?~l__!llsIryp #5>;۫&2ɞD5S%^u[Ȋ}@V^^A_׿_3<Ѯn /% 4blDzOcI=ΐO.o%SzA}i4 >xR5IcrF4 0\ Q.دduDU7]u6=un-D _'|6+0Q6]}OQ/i̖&!ry-{ӛ7tOS1 L"~.'ɨ"gd4?} M`H5x3 p54O#^=NXDbTpLG]5D%ZU?xo@b5Q6ifQX媑hJz uUҜ*e pԽ(\ɕc) _DJf;JvIr*EyFXk3ƜxIϵ!ͲJИj2Sɽ2twcb8{9$REj5| ^jLt*ad>GI|63J& lS1;~B{, LdHC:JFS'_! >W X,`]WU=@3LQu~_i8QvOO [zxw0 :kq2Nv$i4c/KBh C -d5.JY[:gvڞ %мs̒ ɸ g"lR(fP0=ͽ0ܫ%Saۻ뷲isф?s) ,Wz|ec׍,ѪTs`;i[wX8 .'U+1Kg#fHhA(>fu7 MD:ȲeJMY$<5hNaUcmvg ONWSy?1bU|wE p}c5ypҋhZ;Z9XUc%k֠A@1({r6 4Q5f@煾K/L"(iz2N j?X—:NZNGiBUʁt eƸ@Ap M1L%UfܷDXC "}x{#}NŐrma-%k0ND);"Qe^΃\65<=٤mԵ@.DNFaCCS upDXRjjh8qXV߯pZHzs!Pອ,3@n=ii.{FkU'Gȴ>% ,~S"7ٮyJ.v6 37/='KAnێw(YA_{+k$$q:0rm UK^zҙݾF ^[9=a7-:B,˙cRS`FțvsVƣ\<[R݈8u:VT-lzA:lANR-x) SYױp\lec/\F(@5$=8,p/[r^wWĦ:;(vq.9Z>ލ}eǾ`_wׯa_l,<CcI <ׂۘW ]Ѷ!SnjiU~ 3]ǃ]b^k%%x +} zᢦ]Ko-^P'4pn{]ڇV6ge vK>ăDe^SQTڶpw66]JˡD}kD $}ne=ۺѥͳ`!r};$1&6IQqALҀ K}q66ua'0Pkh"ԐͭY:THCö؋^szRp_)\ck~lO DZXkSjw/Fo-olUje쯛6SSWy]mpbtl2aԍv)b*]hb^&cl= ݵKz:{EHT3X+d_,̘/vΉA/;BT< lq/"Yx 1h(.')K^}2(f'"(lW|A<^{{H*|%KDmvUFÌާ^;=")u9n̡\p{-e_p2 ҽ@LcMZ=TDיPږӶ̀n v:d8 lk}$mǠ}Y{CD/l'Ql|iPIb`uEH,œǛH"VFiA\цgǑQWm¶$LE0*6Sf- JS/C1 M.Y Pl[a- }Zjz{$!-Foߚ%VMq6ܳ#Cۀ<9(Zclkׇ-=ZpRmjA+Kyڤ9{T_'@0wۯ[4 E?ǻ}̃EfܪzlMҺزdW+гIvv(ǛIB1NfדyCB$ Fñ{XŠqrvӛhbLoK~<ϫψ*4BFTWeˈq d+%6F'>zĝ\`:wPFB*Ayy,,yN\iqX$[.e5hЭB.QSoG\1ދB+e%sx^N2SJ{C$>Xz1?!,jOpv(9%+tMb|2rL qi9TؒԌѮ{3m#.|OWT8^UNc^WlYhQtض@: 72J[$%ƪުl p&:<'#eSUq;&\Żl 0dͬxn-\*{/KLܮPn𻶻w VWLed'<۵6r&Ҕ2.6 s@sL>i0*MEլ#,}}aPq}yz8\xE7}EZwIr\Kcm2궇n74 m8Jk/e" qg "*č)+G*v!svy - 9R.wra5kz?k)~P-߁Qy۶k?Ve#n8pɫ&[xLJ ҫ)~Vљ^=*p´fU|]*c-dV0j~v@Bfr?Yήi8,! U- Ž0؞$n4L|Gm3γTF̢O|EOt<*MdANNK5\|TW9nOeʞě q24kq"U0v' p 6S&[cmsTC8:yCFt$V\IB[ZezzJrlxA endstream endobj 728 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 730 0 obj << /Length 4419 /Filter /FlateDecode >> stream HWr85["C~r|M<θ,\[X$(Bˋ3gjg!8ޭ(#FsN|a4(?) S?”$d> Hƫ|y 'דNO+#㋓QPQ2;5%ϲZU^+Q6FjCX61Ӎ2lŸy.+"ЃXy+ AsB}{YVh$W2ㅬ6GaH4>) W\!c| /~= pʆ#mBؔma69ũd^+S 0xQ#A@c^O+]nದJ_WbK(B|ӚW8]Pbj?/tU[WuG !Y 뒵%8*KS5}J}B"Ϧ/zD2G֢+fPwl&EW:o1u5d^.7Ct6+taZSGV.իCo^asU(f|R<3~ "U+KSj!}l}ad`nD]Ȳs=r* Z,rg^H)p gUCd=kS6^ z [tQ^T#.Ѝl]Y.*eKvY\ zUrS;1hBΤ:d .fʺuH\JxIlkN1|RE9Y82:;U_uBVhZ/r#'%\Cj*aIԴt B왰sUid}H;/LU=H5*0ҍ\KtJ`/>laoMwb6!pF4~X{kueH;AWز´#+-f*1MKvQ,_ mza0 9bxnh>T8 ~5n>+Ivx9L"nSuשm-FzY4Ҩm]W^ѿNѣB1y NN\dzA5MŔ7/+ 6\6x?W5/!?M#q5p/qzQZd"VϖC{)d#vPz3REbK1v풋]66DOPKc% k[a V%6*}(K,u&No*JY -%l[^l2Z.%Ѝ(og m)Mh\rkHbrO0<kPfhv; \O^Bd w_VYk5ӹؗ^6̉ݥmPޞCB@9š 4zekZ؝FT*8y^f-1L_č,KS{#$M !0_mE ˖fL9ڦ"S@-iKr`߁kn/{"wY5Z3hKiҾ};Рq+p<].4&VC܈]rz,9&%L &n>z$_ЏF~l'B'g[nvӰ}Ѻ*ؔԽS m⛑Mpf3_ɡ;WaZnOÓCN:2c4=`ċ4-icNxʈ$^DÝRo_aq/ HӔq|ny-Q ;2{&,)Sa;H\(c˔}d'>] DZ2_ ;rrf'h+%B(:*BBNsհT&+5LqwDh&c)v6do@CQi, 07}ѱvcl̬ւ$nAհ@%>,cw"ӤK%+W2Ji dEϽ0N[ͻY`0<㭳#ӢsfOPT1zv:xY"˱iEFxLۚKi.ukCUF&l&JB7 -u}B1:)6:o[Ӧ޲A#JycŜ*i^0(eK5SƄn9tmTz7V>McR$(+ҢK^{]rXBu_%ۤϵ͜{LE+\MU;4a0Qm ,6Z,iqBNzC+vhVn!``dUrAX,S﯅lnƚUC;/wr{4 ,w-O F@sz=0} 1r~/YP ĉGCTc;Bbs:KC%K4znZWg#o2],L gruI 6)ё.Ή' *ha'Τ"J=CQbZOZ{X"L zh8Neu |O]M놫mn0PIh{nj HTr*ݤ{t䱰׭D*Vf}nXفyYsLB{RfE oViqX'g@% /жL0 J]#t,ċ%@h1u:T1h>ؽ^K*526AOs!Go_sη29l`Zcc' U1{dYia;ls&Eu ?t0SF'2k szۿ`K endstream endobj 731 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F9 54 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 733 0 obj << /Length 3593 /Filter /FlateDecode >> stream HW۸}/"E8A˴^IRu7 IIu" kIÙ3gܽ,f]")X/,%:ʖlSEY^9f. (J٦ijE*^nN".(l)̼zțRL6jھ"Zuy@0ϗ+$^*|(``x]%ݤ8+eZlô? @oy'J_ft;ѼiB>֧Jז)c>TRĒ4:g+@,ŀ$ˣxk)B0g-ת XE4rXTeӻ77~%84((YJU&crUt|XH}fײN1ZZ-@t"At(.LG:6A46f hUia[v[Ђo|U-vL%ɩšs24dF1B`[ -jtkEefQjL+*y TęY זɰ\6]@(X[% +֗[-;Y`ex^A#l;8^y J}ôd2فKS\Y<uu4_MSQ6C)(wwaJx# €kcvN6>Q֋ּF 0›nJ=bL@\:4&AG E z⺓e_q3jv}_Buclo0p5JH)U[FHvFmi81Gz0?7莲y 9Hh[~z[wEU:-}'Z/qh@hʡ[53!Ss{@BDk;U>[f.IW5,xja'[Z#bcrG-nKH;Is,R|"X!8d_8rD>xtlU-)۝P0l¶OY6-OQ:&5~#idLhmCN,X-G+UYXzMF=uz=/d(x/cŒ0ܶzFȹrѠo[sJ¬(VtcxԦ!rx*5;QJH^EӈA$V2ʐF IВL+?'AiOSS֗(&Kբ K2S&3i0.iv9)zWƗh"V c7υt9 B μ䨼D+ufєV؁Cgު 5)Pp HfE k,/LPZt^fk6nqOsq2]tU_=V]dDlZqfs""'QAPܜ#lU="V辝g܋l/ۏt Aې9}X}CwtgAj컊 *ךGf sjQYtv#Oqnz[(C5Xx&Q,ˁW5oMok_cXJ%;"Z[phInWl?c<4ԦYفrL0lN Ifa./v 7|}E^c@0UHih?+ݑlp"(p˷Ҭp~Hcd;E3pMYc|.);7qV1^36\ܥx }\HB4ڕ.~#z04 ; i'F:Gvvհ\^X_iWp`v 7.qĒR8r6ǚ>:2h: ™f >1 '!*&fqߪː,׋0W ˋ0hݭ,IٞXӼ3؄-i#חmzeE1_Ҋ+߄Qb>q">w&ůpPNMTģZެ`+iG.Y9Oӡ6ieH} rOsLY9*8ns82AMUK%Wl;:T7F8ȝF\`,,rX?b;5/үIc,^$&u?NiI;WªIյWXਛzM;&ή|@"c6•> /ExtGState << /GS1 12 0 R >> >> endobj 737 0 obj << /Length 4053 /Filter /FlateDecode >> stream HW[r8]OgJBʗ4]ҩ|@$$!H AYQ/h3 eqTRq,y^|G"h>c(? ,A1QQ<#mY 2g9ɂo\`͑4lnމ/;^B!Y˺RhЍP7Vq)L̼k] ( f/CeB "B&!IQ8"15hCz#ZdūVzڭ@9ĥJވ+^i␷hQf[:N_W&PD4F)pBKԢi-Zҟϕ:U--ܬx[s1N)q_'B&G1$Vϝ6̀9X؛~B6/mSC1fD70JMl׷˛娐'Kg,$Ji ATh% oysShu6e4lfz,wi5_Ț,w/z-QC>*(1oV;w_Thx;c7( @j^u#70_ϏjׇmoJtTm[xU(m2튻g_%XwJM GB}}!תE‹02f̯r!ʸ_'xy A&jb,0)Pϐluj[0I ^աf,0AbV(4i^\*iԓk@Z=!yY>^LY0ӎpƂ'B0}y)Q)(j&\ d`ʢ[%n☜%mG!8 3 "uyOÐ'a;>FE4rQ cqNs425=SPN iDVܭ yZ*%Ib' k=š13E u@OBi Gys% ]F뙥N)/R~uaHw,@xQɛ(Q!*L[a6ev;޲tp9ނ 3W)2`2k9kG_4 3PM%8}I1 S>Gfr',nrgsDDd?!@Ǐ0Q2TQZ8?I&wO:.=$)k8@)\q$%(:"aN^+Q /$߃W膷P#o܋T3хHā1) +aw@T@\GMCHN-8o|rRhBQ{ #2;rTAydk /JY)O-q57`ۭ{Sn,9 D*0:)'FP/PX-!}&`%*Z7@>?) M~JN=iGd`4Nĩr(.GG??-ΘRLҳZU +bC+ ;Z)ᔥщvSa!80¤/GV¬'&Mgl坦^K>3[j@N_.QY^c@6w7.|{{xX6B30$8 XR8J.Ή&[EzR3F;=so'qb $9a1BG2knUP_n&: T6QeH2A8 %cs `;Pۺvca'EI\Q|{a8k;QHĤ?7@˴{ޅ=q4Q(}&:C:Tj̍ܫEf{eZP:©L各^^ϯM\lOnc4}}&7Meb 2`@ -xO%J[{gc1d^¹q}e> /ExtGState << /GS1 12 0 R >> >> endobj 740 0 obj << /Length 4385 /Filter /FlateDecode >> stream HWے۸}͏,"vDO1QN$QdU=DGF^+#{ ߬6ˈFQ>,~~+ꍲD佩R *́K3k{5DÇVyd j-!d3ToU϶EuXS*Ÿ4iLmNZ=`i_Fc?{4!IDw+Kϧأ3sAHbC7svTG?5 "օixXEa hبJ[l„[z0$ 9H(GoE#m@ '$'=%1S.< <!x'8ؽ)EXO'eĘ (" m<ڹ>) G_ h8Ӝc1kI b袞X8~ʵ0B>Xn}fUr-2v>/6;ImQ:SRT2Ϗp|G߆w=mh9ON5 t$Vء|qWF]^r`]L!S!:&F\qS\+ ZbY=%ER@]ġpiqۉSȢ(ĕ Vq'e0ndB5Qzڎ euCy:#Cjz Ð*l#*^Zif.z8BkE,i`@wL]>R9au%399_ۗ|uQ);^$0]Մ!k_͍Bͽ)4#FԈ_a 9y[5p|-ԇTg4J5Q]fQ9̓+즋 ͓\|)'Şa' yf< 7b䔛ӾniÆs)G5h Ĺ*bSU\vhZgDŽ5PEAE>wcys,|.ˢ62'ۛ)g(s?\a2@ԩڳ+IکɃ)gh9"qw^$Glcǐ"Aɔ.#YX2@8;/T9\ :ɔ`̶g88b%rDԢW0$0lFw7wo9=0%.DƧQqz4JiTa De]* K4"_#(5 GАJq#ݮ܋` OŁ(}Qe);=rppy_朳Ya8;co([bC4`X 8  {y塚1:oٵw'㓪[A@t8d EO@ S`i(e]CoԦ!Mk;˽&YWu"9)ê1x])lTʤ qڬ%.^]3}3w4K& mg8ͺ8'b =[-,Ҝf@YTdz^uaN5a-` !K2gqC/'Q2WU܌̥3$̵x^lvp1|.?(P[YyıNV|8cC f~-*];ҕ.CIp^%q1 =ގ1bvbذSȉ)!?^7#F )BY$7/M&9*'Jyn|GB5^M(9OC(9\zyzʔ^U :¯I9_?b<|`{@hj>6_x;$7^gGnŪ^9Gh 1=:p>\ٕ-ZoX}?{C'Fc{jg.L.0Xy'~_V|h{~oSI;bB0x2n;===}*JvD+b#1ݣVp_m=חҤIҹT'wc 3]7"n{A@vwܟs502 U9!t51TFT֐ڮ6&o6uħvr#!s2kH*!LY좝]N=R4ngk\, sE8Ԟ]-Z4a/!.w$rijn⛭U1.kF^ EtHL^Ɉ) aM(SXHg1/#t0BIKj[XN9ny; 쩭|/^@C M!¹ j;EE 5dOg mVUUN9l]bBGLJ'6U $6a6mSqv %ue 6T4}FŎBI!ò+6r2(~=c $xGE Mli *R,g'CpLmF^rkZj]*+AEr3!m!&~H5Q x#j2l9]I_M< {'@ btɘvҒPjM*:@ڼ@ii1|c Oc tDE,!TLe5FAdOJYtH In4S2uZNXN+iElR:JEtӹktѩT*&P x*B6D˜UX "TU"(BHՄ:OBN PC!dlU*B7JHEp,1JPP<$"Tmd5q|҆YVahH.F\$[q Ԑ@F:PPb,1e1'UiM䲸٘@.QGB1c{xYBfMDwK(}U%dn?W3eãvf/eQͳ_a endstream endobj 741 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 743 0 obj << /Length 4751 /Filter /FlateDecode >> stream HWɖZv4K8q΢,6)+H'@Rdc"7w}?o޼}&gYCF b7?~sOxsg{` M<~}le-c͖;DM>M-om6^TNt4c+Q <'rY#Xnm ]Nб3Tۏȃ7(fESw^N/>SϿ=빱~^EeݳcTl…WwX }9eqLQ/*ܴ'y $~XܳgbVԯ.DtGŞu'i:~F*Ȥ3WM[ ޳ax<;zE*G6qs9jktAbRĺ*훾|A % iN[͢z^ROC@Yu_3쓬h {t> ӃuhgH\veVM"riKN2s-v/cQ*oeVDvA:犎< 'jR?T 9eMZjyegIɶr+vDV(yG m% iK}a/K((Zr[gbVwiTSxTo|l/׭n .bXPP-6 eQ)vk͚KaWIs-Obo_I+tMp־ Pn,8~ JVNnO+^?iH34|y1He*~hel_ȾQ;^}ހ04.8nN'Q\G#S\?h ؐߊx_bG5y<ӜߵpfD[q UVZC+U0OilWmafFD _t]ƆCU'Fģ(|FʤeQDW: in] Ma/dhmSľ5sz#3LW1앗|StS8Jc8 3Pk=p@y5}0'K @SIR7w=+Qjum#̍-׬I Z{3wLA=ꄏ *i{j3l^4k>z P# `S ~5l˯ jYlu{M9Siw1['wMRH[9lYx1lYc꤬/-B[9 mMCng\&1  6 ]ӝcs]rt:oU @Ia{f{j<lVr}Cg'7GyG';ϳbT)h|/'$Ϥ;eеĆz41G =W6gƁN٪jv31+ G@5q$`柅b9\λ,ǿ8D3n}PHß M{8"1|OXNڮ9C6ؙ^N ݠwF5S'KuqCSֽ&ƀMt +e yf <4AMȅ'nn:  tRI_eQwjC(T=F˜q_u=(О0Z1ªٮd v\}p=xB5Lߚ#"O3Hªwy@=5wT]t~dYөS$Nq릓E-~U34UWjŗ_ľI0t @k\_jM l-Iwz!T Vjt1|/*q<pl s-[ Bm!Af ?u:i+ʝa|@?3whIP)Q`AFo%}fH_E2WT8t)5Z;wA6F-7`jHw.EJsYⳋ* )5$?{eDMىg`̉@| jmۈv$cxaNb"rh,$m;C53sÃ"mWI, ;yCĜy H ;w Cg I]2%797:|fH+u‹_v ȅȃZi(| obR}F9YUZTcsQPLX6 mwng ޏcw^k`Pa 6>AK '䰎Y,謤FSڲ\y ) r3 v@5'v #{ Ί,)>a¨w'UU(L HOODvédWESahIjeG6 8?;%>^*W n0.#F̡ iZCi(º46wŦAtgDƙ|fUkKЃ`!2 9v`.skt*%Y;{iXhGj1(ƕ[$ *rTˊmGvb=KYWw]mT9(fy_kUr%E҅n:tKЋK%1Q8u \xtoM J_nnMp\&H85kّ]Sk.FEqOnn% `"#3PeU"Pô'c]`u \y$p\tjy*@h 4(Ԏ _Ѣ5mMpU`վk`f#,=$L%D703/g-ٗ_/|o &4( Azw~,/& X4d3$ruH/CCTh'ߏqpWDq(Y,42#rOC +Hr?0KZjIX%l.ߍ-uh.1K_eD#qx| hdi$g#qo0V6h-m`ψeOk$Ք=*a7ȿA2sov},̗ն'T۷V25g¬JpNI}dڦa_ MPk=~Xhe?< G{Mh9I02"gcMn[ Z[c5{4>Δ}U>(ZnwSč<3Dj b L4 Ey&zZ:%E!1.3(a>)C\2rGLZ$ErI"fG!)[$ń/ۦTM!`Ԟcn]OЦfthY B#M57;wmݺ\jms=Gy m6x sMxк"|hkH`-Gj<,mY=@6MTM41*!6UȄ2\*QoU7^&""=@$4YatiqK<kb y`^7cP|QM*v~R*,*WvOf}-JR =a#b"4Y{'侘Ē *ip=-ֺٓ&ǀ`$335ff~ x #}{+6vP~pbu"6w> /ExtGState << /GS1 12 0 R >> >> endobj 746 0 obj << /Length 7768 /Filter /FlateDecode >> stream HWrGC Ur4-8P:4" ֠bC?Fh9t𐕕Wog],r{v]n<})/ r~X}w8va}c_ޱ3l1?>g/?",B'vg/*β ;%;,J7[|R擦 ީ'?NplK?ݱ8Nk8>z8L? d= ="=w!)0kd =~<쳷~Tf=#!䶦 ]p *q|9ᰛ`sG6lvxs\é H\:x=,dAY>k@kZe.LwV,(dG8Һh]}I"x9㫸*& ;S幏uI/.,+*.]g\gcdo׷$!(.хgL.c*~UܥJZכ[ Ӱ(pF,+TD/{aD#[40ߔK@3;H7r;_چa,i{P+_˗,S'8뒥sPiH)jZFSn;qkD~7j0޽äuLo)ϔRйiB$Oc3 X0d@~YO&MEfYOvQ^T0קs`U*jMYq7Rc%40dk9N8i;y=wȮr}}qdCaN"HA7э_ro^iԲO6sso_nu|[)'o|ٜD5RASGxJ]z*7p@%uu>4^+֏l{ qyz-FQ`?6$N-_|Aѯ7Sܽ`W:>t-5ƇԵjU~ns{X250g!\Y xOsZC74SOGNw{۸<{WB;ü(}izK^VdX{Zʦ:i\9gA=s_,MqҐ ;9DK?e"Ŵ E,*ݷ<~az@cܹy)ݏ |L@{I?{SuU(?5rͧۀ.|s93a/g`kk:_A*X`z8W9]; %(]Ct\Cv phq2 1 *#Bke>%X`mȈO(m*V6!Άt] Ȅ 8>Ki u$yolB臛MmqFSNH̍j}v"N/RB%ĔGr9Qu$ }mZ6 ?.$3Ȱ3_!sp?g!MJJ.((j4tiR3HӾ?0-c@h{nXo }<6{ E6@ +[QAj"]Eq:oUjt\ dq$v>JC1Y$#Bx)+2pc:Z7iكm~WUɉw ߦ&4O.*b θRkl DzD*rOS ?11*IՍُ)(Ї?DiA<ϷDjh@O*\":T$(+dJubsrbU ϴMta/4V҄\ДtdFJ(*4uNQGBx|D||X@E0E<(Pɦ.(9}?rq]L%',6!^g1I/t""!5= )V D hZEAl2GRuT1ھ cI`QlbvsQՋ @!9*s2!nF1Qf'DTӤ!M 8e2M!N= &4!rGBhe*՝.[O3y"!ƴ4'S6՞G p^79!Ą-|[BnO2(#B1 H%t>%m8eZd+ BA0A 1$L؄n@]E͘WB䶔pm~W a)5D<Ioc:m14(YiGH%6h=Wr\ eyAMTor!/#(FùFJ[RwA,W*a.ec~Z5UD^dz紁ĹdM&Ow%$U۰ie+-Kܼ%q4"-V-;CxSH]yxrf K %)RScu'-7~ ;XBZ,}@j R@h^ dPBX.uCO8W.3E>lmNZύ-kKh_df_(Toe:&> ƵOOǿn??}|Ipk;\drQ4SG#TUn1*o*܌tV)6{JFer2dh炈.`~όȩȹ~Ğw{qsa 'I{K(OX0Q8BG ('A8~ dްopËm ۩5/m~jmx'!3Mׇ !AMF' &#"MHT+H$RuDj$dV1뚔@"ձ3 $kcL$JHv̪zqop"5DbL "99(;ҽ*FaæId`fsHow996}(wv񝢽,eHk]n Zv$] 8.j,r $s$o̪çtL!.7XO9,#%b@R#-IjtVΩzNNH\)X[|YѯקO[>}Z|^>̳nmg£t6-Hz Vԏ "BD,7_PϕS׼&)1Qh9)Q8}o?&5IdKJ,] mLFBٖZHCt?-Ɗ~ɾ1'2߳ M uJp|U@H"yA\g(5y2D98"I<HcMß"%r+UGt "Md7f R]GBRe(V:"#)ZHqE8*s_E]ps1bx`؆r [ƒZdrD/\m\pzpPSp &K|&D6"SI1X"HcMjU%=i Dj)0lA 22)gFՏg8'ԱO$Ԋe{itFld?h>6Z!R$>+x+ MD1\?tx 9%6nW2O^VI< pLaF䅢o < ݫ.c4 (nCpG|/H@$UQrC"$94j#FH;P `T @Rj6"4e ud{HbGJԓ0EArdH9R!OE;YIt$&H͙9Wi^'nR.Pj{'*1R:-¿9AZH"c)/w\v )_{n<ʋ?{_[S54Oچ|+A?Jv;wzD#WѶ,!@oV,bL [Tx'F,ID[euxe2g'( ? ,K ʸkw>qa&D!z"5`!OT7 gr3  ^c>%Ѧ$#d~܃髤$v{f$ì$|JU Sj IXd4ӹxz8T(GSiS -+D|N*Z~Bfiwz MBHw$dZ?ERY/=#>k[5Ml,9 "dβDca5u.k2%{\ϊk5 H[f7^ uҭK#l,Ax }3qSG h@BH$*Vΐd{qI®g׫7s!f-AZ( oXmѪz=4Hsn;%yD߻ 9wedj'70"2OslMMFnYO#Ǩ>Hg0W[ 8\1#־Y` :wRG>0"lxn(j^._̣?i7UN&[ R3 Yru:.Ufг~YcC&^ vtWZ7u6sY,<~>]Yq;fV2U\%N׈4qj,F=(I\P,9 RG?IB'DָΰzjOh_{A8wOݏ/O>~5uюW}H_#0i݌n$9b=эXlR3SȨd/ESS#=!׷v4cv*֬-^{\>Ze YF/S21iNSMS~o9EJ>ǹ;ڏgE<Oz7C ( v艷k tK$CHXFbOQ@5Vv$J%%Aq-Iy(2~TdCފCID\g47x턮K?ś\k$a*&CVFF6 D2I#V(**#,U]AB ^$AN )3q*B""®^]?ԾA|^v[1iKG&FnXj:Y}߻>Y/^r?j3W@ʼTċT6\g{GGs $꩐&$N[O1&)&$^y4L 1u#{G :Y긃'u290)5|=fE~x3F9r+u} " f} ~!bjf6%Ğ=a7MKD'ႯxIƨI$F Aiv8LϔǺ2MGkS!3yO/[@WU/B9#2FZyg< 8zgu&җnhbʈbu$D,׈&8ɀ]HYdEeFLH($+/~h AS C">fY ̑D2bYb5̽c6R$Vy@f|Z% kA|(VɈw[;7=L|:Qu:,69 i7\mU/^̴ y cSligze`hpE"i(s4?_ cEc@&F:#)+@e9N}t\ͫ+8I,~H "3MYϺS~/@I+j 4'@k1֊>t49u(i =~UO1+1Dxy$f>K59B^$+[m>KoZiz}|Ri ?h hk×9dxuiU!Uu88Uu\&y6/[AcL INQS$['n}Y O)] endstream endobj 747 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 749 0 obj << /Length 4766 /Filter /FlateDecode >> stream HWKs8pT, HDIkmXջS+[Y NEbFB0ּ|mϺN7 ")SNGך+R ȂQE3&Z}O$8ֺ(&6ńƊXRDb4v9({ +mZ7PLkՏKhh1XhT<]yIVC%\쩊UbemüsɀF|Q1 yH~0(WDidTAv ЦB0>RK0 cv( *#ub`&7E >վ!0A*/ RV-!G&K&Ijy[M޴.nT]bp2d4r& p/ӀWQ2 _5XAjM[|\b=̓ tXJ.  Ppπ40ƃ.ru~=9Ƞ7U}P=Wų6Ȓ*69!!j6|,@{:fc-}7KDQW{֢Hd|^40Εaf[y?}ZҌ3C!F$3F#XCI؄OL(N# ,`P SypW4(GPp}K8UHYq lGT=Dѷoƻi !=dC)OTP% Rt1G-t@ΣQbTB4#a,t<,L\#GI7H"شyꓨg,?SST0_:[Q귫LI< K7eg0;P@ܼP+@cGʍ,(IAwo&~}Ϸ{rJHM6$ f n-ߑ彗 ]/EUZY"zm Vi냁IgOVseL`ziZ.ؤ֐&5hܲ].C5k=;±t?׉Hސzoؒ:yJ#z2H ]9$~nW>i.<ކAsJIXH%N}Y66XX*JhcfŖŤ'C"XJL!"bKpNF!HUHu%q"zV2Gqb%xr}Y%Y\fn$!?;NB^pL{@3Fr21U`I!bd72Q'~vg s< 1TԘ-Ha~ yt{8Iy]в^^-x*6N8TgZ5Б"!MDVqM"aZv^foT5XT 3~ ||6G2q9 %JdsҁeǛcW=e80^[z'74 OD"%au}pIO*W{虷W,{|;oo@zA\ā\=VHNZ0DZH+MkPk <-i@Fui4-elHI Br@)l'{X@Ѱ_ތl FÓ$oX r}˓Խ/_(Dn"u%e$ 'w\о\!qœ lU%%jc%2 ^k4x.L߁5e^e)/݊"3M`f yё,? r"䟞{5˼'zWOOOKs~wQw'ic:;k;ܶpf5ig/ggBzPEVÁԪߴ=+ SL)JFgJXSXijj&UJ2`3X x;2XFe{yՍg p* :]si N*B[&$ˠ +铜D#Ky8鉾"%JV|=V(-(%֒ #;Jф~e+.4 ^:JznVR Q}"1=3:3-pd0e"mkP?Nub:ѩriM}^C[X3Y۽A?ѧA{hl[iSAELoV8t[Щ'話 ܅*臩i`Dj.]?/~hz;t>[YЪcxd71ls@b>e%vp߂MNrvuZNܢ>=RGị%13/wV-ӛխkIq3X0l13Y+/o[X [ @hÎ>Γ, THI..NBN_%lLrj R^ ~BJNw8M}T u%yO).8rs Kl6mCu'wՍ /O;oʍeAг-YDoKdl;Y:%,Fگ)|uf&&l;34ϡ =ZoצUN@Qi!x9le^NMY{q!eT2*ZF}$HA"bzla4q݅F@IFuSF(joʨCui/KFhVRo-!]fqh]"`=ϛ  m"n<=P~>Ѹw5C[p#xm:{(bZJM*Җ Oơk emi?ѼSrqJZb'ciK=Evb~t}&3ޟng݋!tQ8!jV*u 9F93uO`󜙁Z@M{+mC/)Z4l }4Ix-z+֦lH6TTdꇨ So)xcs;)r Wtcs?R8c& pZ< p`㌙zEҬieub˞#leȗ eJ6rq {(i ݔr(>8032*Rr-qޡt><6x:b_=uc2Ȼ$Ddd#0 a)Y IEA< I6x$fϑ$<")*5l$ķ· /F -['Oz$"yZ':vgO'ok Gvt:[GqH}^Mv67mM [\veGV;;a`WgA;^Vg{+Z]zo# lC5X]dU1S}=Z3 lThWV%{$}>[B{MZ"9}!N =bB(B{D}V.9*KY<+fZi6a%uWNPQRmFc5fv'&q,Q}9ߞy`w{x9 L3vg}LI0 )80OV< ixptmOҲM#b6 endstream endobj 750 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> /ColorSpace << /Cs14 225 0 R >> >> endobj 752 0 obj << /Length 6076 /Filter /FlateDecode >> stream HWr}BQKU*Y @@ƀ^f!>}{_-f/ 70De%i_q$[x(؇ً7mZ l+9?.^Uݲf^wm}`^V7ſ[@LسůtH7PI.X|=x7iMFT:JWAx%Tf=kͮnVݑuSCbz-xدVG$2 VGzҗ+6WͶ9~AX{=lȎ7s[H/(TH-vݡ~N:*M[Im}rb;Rswwr~iv8/ogs4.ByYӲbY2gvP^;*:&qD^$Ř$ArluSPg,;5?7)Cz9Èy@UAL= SQHUp)/+aYžk>MXUhqogWơ=νF-s!ΞNhTj1 `-˗$Ԓ)R!,SBg5ТSX;\7 PSC&&cQSrZBqmGoȒ5{F~\# EYٽ{O-\3 b  N3Hxv?e:)jKprsLs \>H*)e]Ԅ狴yqĨa^#zYD즳Y-^vD2/sfvgsvһH_0l)lg5R{<^ͪGrv#pcD,Hʈ*"4d$DRq9!/@OH @\j[NXl)Bk@C(xd<thL EwMN*F& 1QrѠ45k#x(\i]œW$iiT4@M~T}BHSZ#IHT>+ 0028VIjЏ?{dF0h\߼+R#{ #л/'(s7w;گ|mꯙ =8Ң*@c5CYT%[0TΉLӵõ]IF¢,ڎH eњDR%2Ŵhq"W dPӸ$ .5$"%$!M Ia Bꢇ 훇YPV]-Z'i>iƁ&G$l˸t$l=0EPb8X;z]&AB&hrO;;B=bUi Jd;G 1]7WWD0,\:G|t+k,0!ٵȅ~" 1]΀=/zrI/*YEKvqwPTvRB .# - 望FeV䆠X*Z O%d9E%z*O3y= ^@i,6תIIl"Eb$C,L%@T=m_N2`9% I*#4E[mdN11R G2ow pEid@t>YD&=3X쓢AT߿ "`$ ڒHQ"D"NRJ1ĘHcG&g  0, ,O //LEX ܚ^kz}PKU*_vKc}0dRdb-k)t=0UR2kR*" ]uH]V`:TtR9fX'FUM[}ʼn1`'B9)cMF0N &?)g͞܊/bt,Pb DO?H :ؤH~OhmC,ӮEb/WL 9B2N 9+߃4I2qu~"cSUNg I|"%YT) @!ce!x#D2 V UH`}(u  OE|!;;l48"Eht{@jX8q)zuaQ$x9 Ȳrϑpd &# mHdR8$G Al]N4#A*H8ͪ4(s~Th1I8CU`Jl)4E@(c*8П"9FV:ZDi#18B['j~$@S,Ww$nk @|Y7ClDԓv͏`} 6͜AQW 6oCwL!8)QGxN!2G;kvC3ڪ$+jPIS]tD' qL$͐2_&kH4vu !H0}bGk8ac@ JGRCh~_3 e?;e+i}ëgVN«CJ{9K`R[rz`l&(_hW~=AeHn;Kb z4bK'Nqjy~BrĥX} k77L&d45 A?p8^4Arҁij8shef(J Rpbr#2! )`rk=TKS\PgŹ=uS,JlP 5ؘ`TNP$N~c21ђL[ЙDbN8ơIo|صZrlT16+ڣ_dIQheIΔ HҼ!9\64ڳ@BVya 50+;`|Q\\r$_77?ހ*6~C%9} <~}'k-bT?f,O`p`aGifBҸ7amft԰nE߲Y0<\y/^fm7>uo`ux8aAcW0#ݐUh/_ryo-5GaɎlTW8~xu-Vk_DÏu~rwÇ>y~:? 㼛g>Ϋ|_monn3< h'U]?z=N7Ӱ: /v{7ny0+XHļg˼_/ ד4pٟ#~MϘ- <] gLح> ϋK:뒫2@o|tm5e86y~u~ ornq{%U'BEwZ,\#n}9Y[miB5tf[ވqsoz>npӫZ'H̵yvyy0*[_2\Z+[1r&2q(7y22z?<^õh g=΋p:x|`qΐtp07X]wǻßW0^m@hlە8)M.E,u Ӓ!I_w/3X $eGט4a1b|DТàhiI@6kڗouKiTHeGޜNǑ^]_N-uUs7,e^:uȂ2dJ+"GHGP f^rXj-b8}[RG1NT n3tf[G-Ai&6jg Ihsķ([5})h%y9&#՞tԻ$ "1)),5őfG8 * j՟7/KFJ6N_X] q᠜ӟ;N[l{A3<6ɽn|$OB(b`#7Ϣ=,@-ggЙ8GzgP{&=W /%"GL=]]y'. RGu7e(d2i V,[ٮԮM R3M5]1AX fd| ^XPZW$/~hR5Kr ;xm!p ȐGg.:z_ǩ endstream endobj 753 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 755 0 obj << /Length 4406 /Filter /FlateDecode >> stream HWKs>[~pU9RW8ȬR-ф) HBH˗Ŗ6i:e j2nڡXAlxp= \-F34e*PerYS!|hm#y 2l`"_t&X6OWv?HM89LjЭ/4}Ҙ#p7a0#kqN1$7q.撦"CcHt{$’3P>LX4-ԦoN#oX˛ Jm:6~hi!޵j8 ΍ꛞ|$X1\:+P/ИPCvBM(Hn=+)@)گ&WYWSpi͹$xCЩ9"L|sgWgyE9V>l4қg{ N%S-g 1n!_U ۪dZzX# cҟ>9]H  ( &v>eΧC4u)"y^bBgZyXcFdGڑvX%ANyv)cf12s(*X,'1+8|#plf`00=1RoT:~,ѴB(xjޛ3bK& u X2CG(Q׃X%Օ9QfbeeqJ 3|--GXl C80s^Hi=JKV9 8gSZؾ*2Ѩ"rNrpIj}5v3`c 9MOctTs* yR *M* wNs9iRwQmRs44o`mrE<'H٦M٧l?% z)p,8h6axcځTpo9^*U` M;,34^}I* WO@0vn CN ;zC+@jo* o]nj 4l(Q0Rb 7afKfjTx'͸< &$S8ϒGfH+7t͕[fd}K\Ҝ2CPFהBngW)WwV&Ǩ%dwSEт".>o[#_WyiMw[*ɹ܎Cݶ9SΫ伣@,#r?PJT>QqxOm TMGW@W| NOA"@I?-T&ӊo#DVBqJ9a"JӢG!B 1'#9vmѺb@86d1[Dj$Y\֎C1֧)%dč,9l ?IĥN%өjpEʿ,XclO ^ӜERkY@Ϫ)W0z:†ުm류.lpy>_UiY#{,@CȠ3Sp`'ɘ1:Lm&pN8ɖL=,σ*V3T㱔`8HRsLY!IvԜOiTXA5TT:+ մ>́ke!o ‘Fh7LjT|_Mp!o/o7Km o\{y#ryțA͘sx9vdkP ͮ@nMSGz@-[R^TeGy^z@T;^U9͖[^恪O(\s gA"T|68{V݆,TΏ ˾AdC,BW(rY2h76Ap}²O^]]GBV\mvͷKa[/nm~nW[l>׻|3^v{Ώ`E/ެ?"Д 6y:n8ě^|u^&n%\8TA*qgqvmڄ5㋪]2|*Ɍi?3teJbL϶>LS*S7<`%!?7tc46a nVn\#n SJN/|nс=_TH6#GSZT#5c"}=f2^KCHN!l>27F/WӔc^. `CRÐF,Qekax^)4T"F|jV/ʶ*dXi#S{6/Z6r h5βJ5^Bh%> 4eb@tI،kD%l-avSstA:#dJMT~P.ЂؤZ7Wd 䣰0֍.pK#PI.d;S,mBt}~"]QИ5=qeumn8p!Oa< endstream endobj 756 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R /F13 311 0 R >> /ExtGState << /GS1 12 0 R >> /ColorSpace << /Cs14 225 0 R >> >> endobj 758 0 obj << /Length 4337 /Filter /FlateDecode >> stream HWr8C?:[Bμq8qYڤQ"$e? eRg6q9HO>}14r7!/,t"?f4YocNO|"TVr,j%=J2]"W9䧶̭e07#\ #Bh΂0 iY@0׋cx^KZeQn[JZWrF\|&^D4ڈ/uǵr?e8q]bLD)Igب mn^m2e?nI`5@y 2 TTIRSz 9y6$pͺN*6 N L$߱=$'A@I&/uAˎ$a) }Ê9ȸX& IzZYIhUuZ! %YT&#WsqXCu Rټ(`^F)̶ɿ=7WG.ZG[U^hJW2B-0MĀYCbFe !<&xx`䳐w3Ch~N,th?n۸ߌ1*#K\iT ut*3p$8;cWߢTb $|B a"=uHuPK%ShiY!|Z4 :p0eyuT,j5r懼ǁfb erq[믗/bSVZZM"=ۢjoU&醪[qҕ*oP@Ӄ,vU%MwQXz[K-݃m+]Gg {V]dxv/13 ƄtO?AX6:w!G`M(pt)Xw_dbr@%z?ã7(96ޖ̤"(6V80kdtNr8BFA!t(|92ϷPc(Gomp)&}oXGUg#`{~|7yhNlM S<}ahwe(V+ Q)JAc*QO6= -ŴAJ'gNj'#/Ps\b)yW"W2,xWFt$ y2F.LX0~,Rny1=C,E S8yA[^ӁhvpZ- RpYd(lTyW_C>b8(ڲ/ q8R莫kz\1?Z{>؃~(a8܎حa"u|'nl(PnۛE] 0? }oYvXE]]7r]Fi+|iϗSr"gTr?EE }@`~:,um/K$>!Yn e"aNwcݩ*sS=Sێq"aej6!Ľx'n΋M&gOR_!:ԚF_xBym [קm΢3s4 B9t^ץkY!]v(8?23`Xy1Fnk>zo8<ng֢Eܱ!2i;I+;fL1aќ<$7:2{U3n!gy8ME܏:Վ[*y3\/p04xFV,p;(g+O%TnjSD@ ZVk.̨ZUf4v2]0DGZШ=_:_ύGM b]@zh/DB5*i:BAKr:<*r\ڥ{tq]˞jn.$і0'MIrInۊ  9 Q/˔"%2g,.'}Pg)Ľ}O5ȋ/AkI4XF9ulb̍dy)\MWy/f'cGIT͉.mq낲Q[N_0;Bgo 6=]\6l[vp! ^>SA8f*.!X9ksVLE;ߣŋ&EVGI?$ۧ#퐖Ϩ4)0Krrp}_@W. M ]`ڨoit$(e~eT|'p̷?ټ0'h|S>q5o&쫝7 \7gP*OĂ<7VW%~oy:u|MMB3'KSdFYۘn,?v+FW93t[/jt|g+IQp!.-8)|#k h=k~V<ɆH=8) G ƺ ?L!1LZH@@|xڌ: =.l h,~W|\>Y>eŇsha;֗ł@Ea ئ)7pI'2L[Sϭy|Xo!E2t&`%~ɩ'ܞIZ@~)6p 4) *&Rٹîsl\ڪJgڋEY%F]ygn܈ 5 dϽ&@/dudvd&kXUieY|V2(^0@ocϞzVSy%A(Z2yej|?KT_L`2fykϻr3PR[:AS8GLۑ)HrW;+U#*^D¯K̉ H3.;Sxxݵ0+-I_j#TЍyp?q&TJ}$13|H̯R$T_hBXaxd:B!`$Red# fg"1H VR# +N:l).e^'a l3} % 1CM*$8@E1:i l-߆'~[`zV~j5<˄U9B!+MPOfSۑ5칞z)`!6Һ\^A0tcщ8a7Hq+|7޸5U\T 1m:/^J{ы*(ѵ̟.@_OH@Ep1һl+T=BevXz=K;rB,QmdjMsYR^@Z?`S5%:j{qJi9i(p˦!jmVN`)Jyuv5jZ \g[[X?E"Zx M7 |lJ endstream endobj 759 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 761 0 obj << /Length 4354 /Filter /FlateDecode >> stream HWے ~8%Ѽeog֮TՒz"MRAMff\S&888<ܼ!TV7 /S< $T0M"xoZ7aar<{8F_\(4tљf|nenjeK*vklj]!C`:8 0=緿T^PI8RUx}$Q,*'A:25AeC6yQ?N O㳳?tv`uI:;J筺=K]?|$L$?ABp'_MK̢$邈A[WإqDz֖}(l (&)>DH :.٩{gn^/W横ݱ̂5sKL8wD* Sޚu~pJ71<ςY6I8 7 _>zdW-i0 `l8 fSBR2yUV[fc*gQJUtWm٨U8(Ȳ|X4ë.CU] C#ekq­MU鞇Tr K5-/{bToZaP7|C0Oa.oF'$ )E#0ݘ .?,~QJvݚ`?4[]Si:ߌχ HTͧ^%gITQY[-LQLnmIvL&u2lF?:rSU! ԧ mU7n.@ Y,T%!G)F\${ZRS6V=xc^Lj _CFw嵤F%e:: y31aaXCo{+WQg ۝Z> - `R@wһue@~?etagm " X]W)tZG [1MucU .l_2Q`k(WEKB4ϤvKS #fo83y $IX}Vˍp*rm$>%Q.J`wbQ9TMlD -[8 H+Cc@,Eݮq]# j,סYDӥٙ4n~#JI8gpеZYk99K1 mT+",ڛDdJ='f%6ٖtC/zXK[^?uukKAi')Ωq߶{V=͑n#9%+$ULϤϤxvVfeMA lP/*8*S 5IyziK[ox Y[Z |a֕FQ+Kaзphd7qF<_ԏLVH̢r‡ PAa[kD`ls0ac)VJb6#IXyIݙFO\A iq$]ze㊔W&!u|΂ / YdZ,AG"7xA3%A Պo4H5=ɷWCla`YGTxĚ84*F%/=zZFJ%-jHdv>3lx yamcL={E~ݓV0 aI X(:}8ٴ)![^8o..?kEIta" X-ZrȰN&u@g֛MJ:il/#|N`]VPPs0̈́c2<6ח\JWV3\7FocכhEhjǼ<M6/!mгB>V? nBi~kIV j$#Ϯ4a)7B@EIK4$2 h ǥɹW4U ?`l9-)iY6M+n8)*1J+zIB"v8~Of!iK6U7Y Wysuպc]/Ѽ>*dQڳm$H_ 9H(j̥Q}Q/g.Q0$sH<̳X)fqخK㝬;mTF/cl*-IFV.Uyƫdq#~A3`)ǃLf \(%1.L~(E` &ky .˿c-աuκ"׍ƩGKp+CءI zIjHL"+,jăQrnM³A=a-&(5Qwv1t#,pw٠-dזLZ`.Zt^њ,ul+05=Ţi|6fA!ZP9c݂iO)֐ bAC)NP݋ g ZjQ)H1 Tjqm]][k~fw'N'WV帞]qh۵EEĺ>VzʟhR~ei5_3ΩI{h#Y^C5CA؏AX@z'E'C]F-3ok,ܣ'zU ө ÷޴/@"G0g5~gf] \{Kq[ 't[1j7*1qDv֩*Qp59XݴYni)=HLsMNjoy{\<> e`No/Y)^ԗNٖjGEV¢ܰ!&4A;^x+`PH?K3bDŽ'nˢGbōK';HQAe@[F8JoC%I!yU7F( 6=œs.xJ%8q&M>/IɨoF '1v_,mN;ti\Li[R.+c TP=U_غHMӼj'[Q*1KiCC&iu1ov!!E$P{v3ƳHS]eCHJ)G8':t=uZMeqcKoOO^t߸nUj RƗ/7P['ڵ؆e4|8~9>6/:ɸAk/[[b(A3dTc> /ExtGState << /GS1 12 0 R >> >> endobj 764 0 obj << /Length 4372 /Filter /FlateDecode >> stream HWے۸F!.c!d,N`,MA \݅aľ޽SvOQ<}I0H=ϕiXdrI#;"5ZnZھ_*Ȗӿ6g aJ3#QSXit Xq|S f 1l+~g`~uūFٲlb?>=w G)q]ՉU>|JhwE/ˑ$~EMQzilHwe/xUY(me*<@ Bu#mY={|ؓ6'QG]"ꀘ7I6{|o(ϬDE>=5|pܰbi~z!KLՂU 0BU[x]ڝk W+IZU k:QE3UG|hYv 7Au\(tp$*yGaJtY"3vxSؗ7E\ \$j"HmVAQX^,J֜2sY*ojc'Yl.FK| $Qq[. g{"G"]*a, ZPRgt1S(7 dƮ7"^TqV!J@-ꐫ jCE[3, ?(MF}dwP%۞5!)΅ָJS#$Y]Sqt.Qvv=];"kuW(y; DM|u[Ab)5:ȘLYt!~WƬ]l5~C12WB[܈R,y߾z-h豜zu~<)>GS)I>]za:2 3Nt~ C ii@V=d׍t7l-Ϛְ4d q/͏P@vZ 4ހ^֫MLhC[bύǑXKFKńXp-FAkFkS#OQ_Kh#) o-{R_ JUrbr$[ȣN­4ZfEί;.,Յ4a``{s"wWfd#fćFXgɧ#aaYk^1;F% >F>@4 l.KK$.Юp;tkXrƮ ągnnc7":>ȷ'@wt4njuU\'ajZK&AgQst((utDmPzG8Щ };sM[]'ríщ^+֍3 Pn!ulݰ-&]DnOƿ8@WwccX[$TH[ޤqFq #AV6t_+Ӟ^aQ֘$'`@*pZk~V-wFg# =f%LZU8b`!œ:BVӸ(e*r mW_i+{va_uK lMkaA;k(8tlжl!@z+VnXZxaD褲w.{9<ʼՄ;j% *&Ai*PQԕdOŽ=:'!/J&X9eA/(E&GKɫWLazYȞGϯ)8H|:v)WL=a+:` 3ZҀ̓*慝0w#3v|/r8=_Ѵ,tkڡ b#aq K>n:Ē{i% E.FlKxmC/?ha{gYɆhY2DiHt$//y=v)FsbuMxl7B̩[m;O=~28 ! [ixKMF3Uit(ν\>"K[mH*;x_o 4kM({ ?hw;=N''ﰼ5fZynal·KͦɉMJCR3Ng;C!\-?Z ĉ><*M|RhxYއ):cLA^~ i('V*ӓߒ~0g!rC@Ӟy/WanӾc ǀHwxj&\7SSOaZl687נ9\fNd.GuQX?ǸNɚ4ЫCx&Ir?i={J[iyI)3Zy $g+vK A_OO$+X6`x;_4$HmNJnM~PBhGI<#-Q0-Im!ZY$tR}-. )CRZ꺓㙦l%'#wf?9 t9\'r/?m[) .#QKť=˫e)DCLA$2Wj#IܐyU2>4m$cjqŰ'a EW׌:E2Rm!/F&] mRQ <X_i);k.3~xxLDRKk mu$W`/XV,ͧŸ́wڛ|\M bȋ|.iOHJ5=UtQSS* H+'M;^Bb$_Gfo`'SL4`Zv3 85Nvs<;֝ӄ !5pmGxV%wo2U?b) k*g=t!#AC\򅹚"wiU|qLQxR>IiiOgB.eY@]/v`i*{BPֲoM5-$,Z=a\e72uVC"5SGwtIQ8ڟp3d^dj٬H)o `Hm[JdZ%Ol&׼</(bcfy[W1t{Z2yC2H ]md^ߨ)ptKkFg9S>MYӿ͵&}ۓEt6)N~fG}U舿V endstream endobj 765 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 768 0 obj << /Length 4801 /Filter /FlateDecode >> stream HWے۸|DSXOiKut!7Fe~siDԛ萬B=510qawHm4@#z~VE;*uy*cíg^=emDPëغL];I6JqP %J Am]0H vݲnF--[Ps2;_KMWRDSr4XDOq2Il=т azQOR . V% 0OYBN' dUOB {C?ҌfK*Hr"@d "]I=^G V)ӷ#!Q9CW?>~~0B}+OQb jkl"\;3{Kt+hF@P}"b !Kv!EY[;6(+Վ3ټ DCL,ˣlz2zx5hHURLjQZ(~`Lxvdr%idBŎ4})ZXz0_kVi"00L/`GaFO㓒 l /?, EkF˧h}:/qN=rr^)ZYCwHQj/Z 9hlkpTe{,Q9ae0nZ^le]hS4&EAνA?6h CstOxvqqdi4`V6HSDՂc%JUb6^.O?5j)w谱(_DI*'Dꡭԗn65PA5F%iVW42eւWyq|SɶAeEiV}Elf._"!tsY 89N0?Q>#D+Iȶz(.EL" q%ఖJ ټevEcg_G2r,ojgzJUk`sD/itfe*Xf򈙉C[:`gGQ Ѩb5qt snǦQLH@9SY d7 xYcaokUjN%st.IbhyH6,IWDZxڙ|ɝV Qc-tFsN.*2hqz-,TM?NAEɅ7Xi(`"Iy8 .*y䅼rw+ npIO05A<~PAl6?N_D⦠1~Q̥ |{wh. x5DNvMR3A7]@ɳÙv# ou@tѲ )T;;.NHa{1gJDoeBͮa4'I|ޡ$td&^n^0䖖5lw荵fTzjyclkȎ]U6byjnKmH!'=jf=4X OoX:)Mi9P *v}=0[S8J݇ަn;t u'ˋpՕ 6`Y(t!֬MM/ Ä_DmSје3Cl]HZI >d2p6b'KZzKfxcN{<^<,<%h5NImuU+"ӊ{}`q2 7jm+[[dm4i7(mYJ%9t3 ͹$%a'iQ}8&/qszLYLIޞIk࿐v&*-**FvDyo{??miT*/ԏ&h_c:X6kNW @n\M(/MyBR#\:D탄졇jDG lM?U"]Z[3Gbʖnǩ$+2BnggypC;xC<;pcu19SX9#OוL`e^AOe)*~);A>:pgy 9T-7:u[=: 0{lm}|[BEDMzasezwJ 숛F+bdg'^XuySv[lVXn:vQt}c }t%,Zp[ht0pԛ6e:$=7!9f}D7wqap"v;`&ʝ(Ʌ.)<3CSiY&tHÏ̯љxK4dVoOُT I z֘xFgmq5F>em }cap޴"l^qS>/7yh2cޠ Hty@>u4IGpmK$[1S}!g'rѰ&V[&Ϲ#@B9ݥ&aWJt0Vm.%{bͰ$Tʄ&}Į r\CC=o'Pc{l71$,@ ,({Stocy%6+<Ľ}˕6qGn=`C7{,)'d^ ? 7T}U^8eNEt$=dće;DkΫDhEt p84תY_"Nkd}-daMShjru&Sα-v٪iB|W*:"p;/:3eEzZ5˔>hnt\_,RH|%vx<2vSrOyb(zQ,$;Ya,|elP ד<~{}(-eT$[u`"k&vl"pL21fVR"%5Ikh/xZBl!M5#wRrQDV ߟ]/2̉cx#x3I1sI+ Ɓ#aE;MϢWmP yu,^%v~hZvXt`8!U [4\7M?8 mϟɣ(+(:畔AA6 v.Y?O,`&;8=^[P)_29i+DMe%Tt <:=jñk J`q{}CJ+q/)W/ Cz%1豚w 0RQ^ endstream endobj 769 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 771 0 obj << /Length 724 /Filter /FlateDecode >> stream HTR0]N"$d $e(0Ĕ aD#Ll+m2Nvҹg% {RK!>M !!x2X{ 5d7RϿyi*t.kP.^RT FMGЧ8ɾͬRlNIH&,ܵŋJڊW1+Rn0S[עXW8L7hHv>ؚ,1r',eڽq"x؏a*ˎ'Q-ѩ4V 1taL83F^KZL5̿oe6R[Q6E kGJK쩞nkt1j9YBVhn Vu`;otajd)?$ЈC;ҋ\I>p0c9lfq0aIH:+XH8MS ;!J=bt| ,l4 endstream endobj 772 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 774 0 obj << /Length 4693 /Filter /FlateDecode >> stream HWr6}~:;2oQ/7IwiN[$D$%@+uvgg@N'{=7' Kr}`1,XZeQ Q[vW7K\Q[<\]'3}$4mW7nO6\0Љ}FR"*bn(Šݕne= G$O7eiZDy,PUI-_FMz#V3Qn35UIŭ }PT}AI+(C;zbjU4$Jt 6荴LolXed|e9r!iTe [qkFEU=?uKHljت׼ /xIYzpwCknH Jl?E=VnZ JӐYƠ[P Z}`k{$,)@>i8U{lf@-6cml/Ы-m[n2K]چiAVnU+"^146c &W./!!ec w;a]Rrհ^ԺoNI承:5q!z:0dU'oT3[Pb-4k8ngflH0`Z=vxjyd/4yˍҽ`FגI\t存̫+SavS?T?g#Gy{jwF[xo(9<=IV,M<$7ZzY|VfC415bJѥrpsERYGAgWӀq{ TQ Hڀ3GCNKr?x`<7Vt\=Rb1_E;%'3=]1)+@Yj'U͒E߿rIzdVO_z)l݌q;-@ۓE5s(Cr~CV'8eY>NFRN H6?qi\ YKwhy/z1] W? n-E3dFxC@1Aw;fF !6@_ILz{ѼA}:)dQljWl@x>A-.aSs_:O'H!7A1IV@*LdM:p՘S&/М-@1_#k<8]tjߪ4mih:5 U*~ {܏_t#4Mch& YƁkV=mq+O5Vw7c|'DSE۶Vqۓ{rޣ2r%[o-d'-ROW+jq۵P+me ɩ0ޤuR<-7FZ' iٔ'B$^H;qeg}^")G5W0PrW A0C&ʷ0 `$yu*WPCO_$֛qS=,9c?Za3HPS:2agLIYI1u16J'쳈eq#ko@k> C̷^cEx&$G 1XCO½.<0,xG\ #oaFw亏p~2{hG[A3QTn&Rxx98$NݾՏ<ڡTDAMPgJ &8rK72DЕ! G#hlQ,ptr*Wԗ%yRc` |tLݨq &Bܜ1*\hB|G|IOT=Js.|="x IJ)W)|IR+. {&g'pB5 pFа~__Q6ܥu>"زlJQJOD}Ǭn\]H5^ NYp,ͭR]Ď؝O .ol=(˧c)RPWtyyʢШsdi@Xn,^m!0|bz S?@Z#f/ F)LIuWa("˔ Lccl|(W=3i z8~Bl?OEC 8 MEנOVUWIOVp!nrL(y>)jYO(kFh׋ &+ݵg^2Y+|5t\)L3YXu ΚPǭ\?*:K5,0$WUBJ)q SSfG8TU0] vr1v"vH:i/opem4Ju&+in %=9!,Ҧ~4zh(&ƫ҉Е/zo+|MPqbZ,mY\0WlT7J}84AEoLn<_e}>Lv%-&{"~dELρ±/rtGzVӳ0|Qi&MYCR)l>*6k!{oaA'}'L+q8ʺ0nn0,%"HX0}# WVrs>QC$!~R02Ovw,q,:*>ny\e'Aڹ`iW5/,PkX}Ѷ< =8q5KvxfpY3aiM8a Gg@7HGic&lqnϣ2[L<ql :#g(ܴ¬*Lc7oFMh0@7!Y׮o!į #~!*W:\$weJb%5QaiX8tOu8ZRd=%vʈ@}GN7BKt?#k;0Se^>|Z>NsWބ^&9u^|hKDɹOqG2ϧ-^/A)rcDžܶ*owe)k:qKEO[tE5#ND1PxT<}Kɯ|=e؄?=~O`iN endstream endobj 775 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 777 0 obj << /Length 4718 /Filter /FlateDecode >> stream HWrܸ \fkvekUI"13I _V'F-WY v7O>vw$f o,ƿ-IJ [()57}/7]y8MR&[j~Fp]?TG,_W9qm5ܾf6sVHb^emMAb{K;G;;f6(sг]u!e{LRG"V|0Ga ?& {ЊW%7x̢vˤqiJ*osJkiA Lڊq #gGBxqD+ .[Q&ξ؃Z!= VM˞pj൙'6qٱ7x"*n%+^~\(-+w`{V! ;V<{)CƣZ(pwv5PN{́W R-֫ܛDDZrxj+5R,{o^m 8mݩe`!趕UA rQk#~8j~t`5A14SЂ.^>JaH9#QMBWyo؉RMxk.+a~FhOb]m_EȔzrc9biY`Ofos SڢA.\x*D Q0ѦHBȾH3N `#\uVw8d AlV`Lx!Mp\tf]-ejB{w_R49@`;CGZt?Q_ȗ(?*M9T&箪T֓]H N&~s2%H/G{ M<Ԏ-i;Aˮۢ AÈO<*QJonͥu88G]a&LҴQC ȳqup3įWQT 1.TeId ɩjGi]?З va7 ޟqlȰ%!R а%&+']*jH_S:jGE& VN%s$t@<~D[odCr%f;i' h;hYEI NI{5J"s~F\_죎인CZzFv<`͡\rUz:> Ȟ}*|XhHHϭEMFkZ!gGm4d)[/Vݿ]tJSF˖O-c|_FY]IІٳʷ\#h@eM_)wr;-d͠1"mI)5F./|_\GǶ~[O0xL¿bHQYFb@,}cܪ@:aG9-Qfz>x/҆>*T8;}PV%rljZ d=OȘ3b2I^ս2I50"Vij3~hGpW/Rcx4m_C>0}YS:ii$N(!H{ Iv''m X}?WMeWk$F]qWIҭ@&Yq Zv2U4 _+00'u.1 ey_A! ?YŕVyэpXN6Uf6WcBe,Mt6Hw‘ҖOfY|ٿ/ZM~9_rL@0W 4IABI}HR7"L"q4nN=ՙ0B,P{BjNoᜧEKWauzLE+- FfQ^9[PSDr_v;rH}EggؤNǗ)')Ps K.e*ZX6h<< qVə!V/l8XPW e9z14̹8 "(>tmxf .ц13 w zܒrhXǃmsE̡({2Oe&\ tdz֋xVo.{ݮ$?L%~Ù(pGi{jR$:{$kMx0J `QBǙ\>XX*JFpWц2+P}/ Þ\٥僂 l .P*>>Ёkr )l~^kV' Xo#&]?:/=(d#׷foZj<$^8tᬭ7L2~Jl=X=/:ТmDr4TM ;HPc /tTc37_qjbLdsi-(9MJBt=B0p:v 4o<~{1mmƪC#a=PW@5{8|!(GB+FnߚGqBw:b gGH4Vf_۪wf7m6\ vQthpX<`>7č<|H3fqE&0[4(F,.b.g h1#׈}IX.ܞ.0niJBʳ"5V8Nsm NKwiu9[F_rLTos%S~hW_8Vd_jtCa :L'SOU@[kNa =\XWe50 >p@;LmtbEX#g[IDhKZ!GY*ZT3$_ap -w띳)o]#j_Ҏ,B}m".B%mN B_oD]BS u׀l 3t>=>7k!<`nN$"ҍE!%І5hWPEO:<}X.3Hn}D$aͻfLqs%*i$fk^.Pk2K5)?-W_#R1fXm/9@~ѣ84e_mP )w8֦< 6m>UI".boz&=y -J lvQA+JE X ]ضΊHػہDyYG:2wO#MhHcG!7*uòzZL&X< E=K.Ȱ\+ T9!ztvY03ݠ>fyв|%"b ]7_!}˩0c?=tO 4{X[k_M 6dԊACl@NcRrYԢvBPGcl}ҒY - ',$HLa~?z6 endstream endobj 778 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 780 0 obj << /Length 4980 /Filter /FlateDecode >> stream HWْ<:$IQ1{D;b?@$$adFK,x{z옘K-L|{x.D&vHk+m .6" L<=ys&JE-ě/wRcIs}JQ'}<w1?V|QV;+mm;[<_[yB̳d[6tCg!zf!DlIFI^CQ1J7lU%0^]zs䘇2-$JQ&F 1&BVvl$ÑU5w֋scxl\"jEt9aH*_neR(%R&\ބ# yW0r"M(Z, xwӀVJҕ3ݱsWgK( 0Gmdd^Y2o'?kZGLP]h;UnM351j y)uUǀ?) OaP1^H6_⑈* z/œUH%@WW )t50؂ZU /= чmJ: (Q,y%. 0mC~>v#ʶr!A7 =dTF]<1(u>?PkdR=?{{OhL[RssT0-s!-,KuBp/*5DsӺ1lYĐ8\ΡIeRcZ{A.Z]t$Q+%6xCl߅c^ ʕ]c sHM=D9i{J gR%~:䈟Y EL="h<Q#z|ԉ7"։|F޳5?aj9QD6n[VSTo4QԣnfFNbdSPGT& 11eLX32e玹d7Gznʹ٨&H. b;r0r|Rtq'UURmY &-iA~ tT_$}@Eb>@W_}gdYMĜ,43Gr׽FHM]#Gs _a;nXTPAM - (Vb"k?7ۯ =t1C@9>2ͳ1$OΥ׌6zD;Y12|/=Sqz{FY7Iq2>hV?)ɰB(֯߳<4آc-g+2>@WRtMmOrh<%;w欓|(kɆ10$+*ˢ6#d[&kt4j`D'VAC%uZ96LRoof0dJeYToݙ޳wg`f޾n8 .V.;^M<^gh ?}uR`PvC&ڍ~aA ~"+bճ o!D㝶XM3.c2>1;xPym,r+AGנ=x'+Vĝfu62L ցv m0žӦ u*eF]&lhf_$y$9^Akx Q󂚋c-SGz8%uFp9ʘ>[;0!)MӻȇTـzǧl0ǖ ={9y /; hB%T(uF!:K\2J%d.6x`{ܰC؉Pyr7iSC0j.?WÊUbXu,)C~$t_n;>Jz&S|rbJaK~ HVeI(XsZ`9FZh:UqM:tPE0F4 m<޲t$V:!f q=eԝᖻFl*Г֥ '8;8UPu*Ԣ!NxΔX,_ߟmz9+_`?ϸ<ī:8^9p++ 3%SFPb0X"CUrUVEA_0A zS.'ܶ۫Q_j)yӲgv C yxJ ׸LL]|`dq ]LWݦYM{%dFKϾ&oR.jMta>+B`d=Тa'P S`bf[|r6%詤ac,wA~hi&Fm}w*;TA9 `Lk6Daj5N;f}-0 eoEfatn)R/xzDgTfEBI!jO~;UCTo@*-}<Ρ06[ZBωBb鶎L۶4٣Wov~qv[g<Qo6-g3|kudR;]m) 'u/<w:E/Vp%.Yugj?R6-dzO1'ΕYM|JhڹM%.<%ݫC5j;xcxzv Ks[#2VyS[i,L7M-i<1&T~FtAi;&x'HJt!O)!ҙt[h_v8_g+zI=npյL RA)ѕ9f7{=Nq+i8rm.2o =b*E0Em4 r*\f};r%XhZa]Ysfa̎<:ovY\u7 2/ %VUR" X@nmKi~"}jX p &D?hDwKFkYSܣ ( &G ?*>w'4?5:gUp~U;$@!+vW/gӰ=:UZtGDۧ 5M-ۼdmJZ[dH:dG['sjdDmpqZGFs:#H; > /ExtGState << /GS1 12 0 R >> >> endobj 783 0 obj << /Length 1787 /Filter /FlateDecode >> stream HWn6tY)1oNtHȌF=IN|.Iɑ,M ے{=d:x{N|D~ `AA h"A 4 }><48 ~B̿}L?ۙHL Go !'P!D=/"/uN {"NZ,BHQxƫwnq k Il +:I\R C}Z8bP.fC}?u( E !|Zp QsQT?B4p %tQ{sޠ66o}Y#p)kn;SZީP¸?da`FS_oJ]ixB0j kBTe3K UuR(;0p7a KP\ϋxt .ABV=Ń&κ̍-‚~Nr t"kK]lC vigmB1A9`7̩_ŵ骋x~*[Ʈeg_bΉ&gk(iD;dU:?Fiξ2]暩XypÉ$ pWK$:{{(y( ,{h(0h?u4NޯBy&Ͳ4^ lyr_ 6dИWB:FPj=s$EbE eFuO2ha@.i`NQAr,tdg "!yaSyחRq1A$΀,]QMz2]J3#,ۆ7C!#Mm Qf~E:˸D]vE1|>;0 *s<NFXf ;f׌}*Č$n߱bz裆mLH* 7VXclIse>AǹvLjǾk.S*JS?,hUt=mQwiQmufr=/M_0OpMFs}5 ñzjI< wTNeW X?8=Xaa&it' gCmZӪ5bI&q\ 5"OKwf" l-uT&LjãZ *S3S,u7IOA$U -0AŹuѴP6$,DodC).Mh-G~#-k"DSMNǚĠ?v(@XWc\p+f =BW cD  du5 ˱^X/x-DύA5F6:àhF [t>h <~BWiȆ=>˽S͵. _j_=O0nfгpjb㖪2> /ExtGState << /GS1 12 0 R >> >> endobj 786 0 obj << /Length 4391 /Filter /FlateDecode >> stream HWr} .ױk5uf2u50X@4oisw @I21s=닗o9g7 ODa,A [}ٗ\A[x>\\"}' 9s|)/7}Uu/RmP}TFɮܒ$H$cW<a( :_+/w3…+I'`ȃ(" ٸo ҟ"Ab7_ޝYM Oli%{h;$A|gq777?u y|;G|zǟ$iGA ~kl6O߰VNvîMղmm;Viu6jzלC ,Ϲ j:QFnV[ݲ^}j`Doi< \C4=<"/}g~3RlJ( "πEf-UL⋻F{B1<Ȇ=]Qǭ:mz]Rwo gp "U- ?]#B *ݝ8aʝEU}˥uIk%ܖ\#I poZ4ܒ2M9Qd{.2h{DxlrFp1rkISHC%&lw}+{'s`f$bu h^zh m"PoLi4r7br5ۢ 0y]WSxVmĦf3gSZ9S,mrh5{&͋g왹_Yꠁh,7O%^@gQ k3):*tyͧҍO! e WQ'58X[IQfɶGez_+tdi}=FH=6i=$ /'SwUy#/DGvi\ ;o'? J8E9-g CDP߀pLWğ%9bN 䮵=WvSLv8jk-ӱ{,[pW6 fYGiu2.D͢ebM/ tojN=3=Чmw[ʩSHDPKdYg.sW5iJ JqGӇ+ڞ;T} l^U>ᣃq "f "xHKv[v]{_m^|'8E/>yB|Boleatxl*=~:*UVF#5CE\p0yq`B;D]խ 4<[ e:/>c. 9'wݺxj tZLQ)X+I!J۬8Zn9\5~35ȣS^,tݖʎ}_%_n!SWJ-B[ǝ]u&(Z5e̳K%E\h+R=3KB$dOwi̪ňht6qNƏ]I@u)h%A\Dˢ,U6Wz-ÞIWIC瓜#' FybgeZ]tJhIhdah59#Ok,_ߴ i ݀pKê 3ڦv _vAn',8zs~ͳbz883QX"<^.][|v¿<:~̥d#Z a>ۇ0v=hNt eVDcxW8 n\!Յ B#D5ܡPSv1YUӵWyve~kX]'2ԯ5t.<#!ytݰ}rk0GH_eFt/c.!}BT{ Fd߲|9ė@@OUl؜gV~屗a8yiي6}Űl iS(8)^`:*0tje&7Dޒ@4YJK=(F " ݼjK}n PC]wS̏f> 5Av>mcT0xi!pc?{:=wZ)"- rMp7Q_…/Qop+/w@$,`QG)O-$ta8W;+~oo3=WZ&~ jQ0(4qn'N~`xuSX5ے IsnxNVXSebdn>޽zyjno ߽f·Ea5~$n XzMo;/5# *G[!5xNyS?#-,"V2 c:m.n,Ci$Hme܅94#"BB(SGT mFy&VDZZ <.r/޻Ca. Ĵ!&Qg3}cibz+~iX[ކqEaE^Um(Ӡwpgtz8 8]o)F{53Ovz<6 CbmT89ZCc=c<R)ϒc n晗LCHԋo#)dMu #; w6p?OߙDj97Dfh'zt7J;5I{Zl+5( endstream endobj 787 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 789 0 obj << /Length 4586 /Filter /FlateDecode >> stream HWے۸6DQdWc m{Ռ5dz7zvOZn{Ef^h3EAQ(Y S?z F~#ixR+XE^i- 9ESNS:O80}q^|,y!KiqJ@ J\o(J,^İ`zaw0\m9ׂTaӎ Y;[Pb JeYgZiz!ԼIAD!.׋Z ,S3- E%ہpVg؋hnPAj#Kзs5X,++C/뒣Kh˱,DW06~~w@p-A.( o*T/T Rc`Z]+JTEqV7N yF/`d`l\Vum\X䑟O|h5X{Ką>{- O2rv`zvVf0x gœ$9V&:0,&r9xh-PɉIdg\O-> lBIECdf7iq@+R>Nk7q}aT{c<yE^zaBWZ}GZaЙ|m& |ܛl[GO1 L*p%ҁAI]0;ܲW3p0`c8Ƽ.̝$q|bGsƞ(?R'fg5ZF04^yRZ!OdOM:t|M9iڔzaZSn QUP&EqI633 0B.Lz*<&RHzTBZ[}ހrU,Jn.848B^Ӛ=.eY/yF(d\y;8n]ӡpT~oL3ʟ[rS4Ϛ=ԬZa f7l0ILܐz:58:8(*i{W8 sBq$>1MB}cv>vg:G:o^T ["fg-E6кq\ς㲝5;3.4 :йܟ|>PokׁZɁ*y(kQ9QK>Xo.=voH:U(~8@Sʬ"f/`tQ׃_Zq 0.M6 "ϊv ۽?2;FO$\MV fM)rC{֘Z! sQLaQ=V ,Dֶ$=ʊT.mֽXA- nyގzn_>M0!,TO::n&k]:[%SEtqTR#}% P9P%H^[\g]^پA,U=b`ݭW%SLX^+X=J*-KYE أ:+鿈F-CVRuϢW椕/!yjٰcK#a*\J8Ϧ$8n6khZ={n-"7nC`S~`#̵:/SVda }jkثz5n(9=$ 3ݘf4elP;NS(n=}^ ^hb-ϳ(>I*B 0Լ!66Za26Sg=·gew=̖_-tZ[kFvxf{"iH \"9Ƒ6Da(/x`fphw 嫪ifͻ0MuWfTvzN/tX-q b-SQDpy O3('f,rabN{cUh(7U?P]wԲ6֗h4os4mI4ԞUDkv-ɏe}~m).s;Z$>#fpYMGR xS1`];M`=ʸm1=`$|R I#/ZDBJfIANz`MfD m6PM.å+/}KןY$y'Gz3TdiSГBGb)ħ͇T'R~S}Q,bh;L7/r(NjOz$j1[(V Qr 2|;Vf9y[֏JX{4xu*F|&!^,Z2rdhp3FjUo;/`u[\[-p6=.hOEܲĈQnF 2Hmn@, t/ &sh|Hx02][.4~e4Fɺ ɰ%wD5]8]_. TTO4؞qp|˓Ž>aGرi,ZQS%Ĉyڙ1Hv\ l&Ίc-]s%Aī謼|.s|FO#e;oE$k>5X҆:XE$^T22+U> /ExtGState << /GS1 12 0 R >> >> endobj 792 0 obj << /Length 4577 /Filter /FlateDecode >> stream HWے6<[YnT;vJ+@$$"& - .rÔ$qۇWD$b؈6b.\t>Kb[?D|yxD,l6K"dx"|t+Ň98ՉʝAlK%0f/~kӦrg:'~}S+yҭij8ʟNU&f8 ȑ@4ֵR7NȽS&ExOWpXNH5rJ(~ʙ{G:NtPERv/sNMcSM 7luMS,NB1Z%H '11ىuCYYs h˱5E;5IJtݙe(o>cڈrWUpUѲM]A[(Zn] /P 9 UGPz&Qǻ ߶=X9hD;CuyL'%liNc˕~6M c%L{KkŞ*86 |!BS& b=IzÇt#FTlGʡ˪$SgO+Mw(38B 4lqqTX]6Jjm| Ȫ =MWH d,ə%@0l0,4*fVċ{zlI\8M5kt(?xj,x>P \YM΢ћA*n yUmFֱǮӗW6'jr(C+8 /f5Z/*U5phY֜ ?L`0 d+o5JN5Kt* * ;Dyz 2Fw%)ҞީOa_py(Ԏ2V_%t4tDzf`IA`4XYKazRjcY{tG |r=A5cp/%+ :\ouߞڠ.|vnE1+U⯒Wm!~ieq~5Cky 3٬?17274U۲YwM!ÐXG4־ŽσdD?U?>{!w0yDFoGg=~: Q̶3_9+U@? rRi!6w ai۳qq<OkgoEUM{7eV#EɊb;/3v8Yyq~_NY9q֪bCMvXt'RңrM4eB%lR5圊גtԱOP{u?оlᾔ(GC20p'!ont9]pQ~.̯( /t';ӛ騶s$7'iRS׎93`τ{DU]oBPtDܧ[Uk_8ٝ'mZ=Qåh|Y1H6 Os|@5 #n8{GZ, $ؚYi bfXtGfp95Vxo˼+:ylDswZFoPڛ8(c+j,N!F~ M'SV1yހ]563+<$}'e&2''E7&h`4n5B5v*~Li A%GZV~e~ <}=}o2Mr+p>W>i 8#ow@ 7A!9wپ-pxf*SuI{Uˎv1lЋ/J ?6ߑ] udJ/3ي,dU/ &ߎo0DO0{W>$x 2>EO vm z-gL @`LH8vP˻ȳt3e` ;mkځ,%!nRpdž__6zLJ$iR5L^sDQ'Ǘ7'=MoED 7mRuKyU{ĪJ]1Y7ͅ\y 'uBY#ή`D| 0;16 }NO{G]UY"+ix-[ - (f~|U|1Rڄ=SxVoM_x?\?նD*ь.C@%Hȃ,˶jm,g&?H3xxҨd߲r-1KltѻxuC=9 n?! MX!gFE!}١ޞkb=FNYEň+m^(4zp8'>drdhty YK5TCC(6#6QxwF5*5(W :#9ǶLDep^pk*z+)Xwg;cO=rO7`ƞH#c|G92؄Y? w`zCg^* lE!B^u;="V50_%ӯό46 8TIYܰާn%iFr!,1펎 ¾I4 M9yC-{'85=0Q $k[k6ieV"1]J{WMDY͐,vH)(fa\G|% Idk8>#֧d@fkq (Zj=4f lO0;nr,`=`Tеpe[In )6d 5NEg44l#X{VVd5jY @:5 }ЏlL.m8 N!MniwQ=ͼ!Q@[m 6㼡0"әM;KsoړMԊE ZĂG)P l[kD 3r{4 &!ѪgvHz"6ذډaqd^#LHCG;M1z^I 5Cn xa40 =xŽ1HS".YL'ކh*TIE[3 TyB'=yƏwVn Q"VBz)`coY'ڳ!QNY Uuu:"/%dAŁ"6DI O8v*Zn|33x=-!D!}=m|yB^է\'E_re]>R!¯ϬV͢ fە,Fo  MտnQ<\yCZZI~j;+1:&jqN\LiLMK^jD$7h'2 #(`岉m L߶iPܓ/U}7!<'/lYʜ| bOO`= endstream endobj 793 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 795 0 obj << /Length 2435 /Filter /FlateDecode >> stream HWrۺ:JGB 8V_` PQʋm?_t %RN7O''/<|NpH ^),OK'$>y<`<}irStfҼ\ ݫ\,wG?7f"0LO=G`$b֋O3jxb\N:ڬU6D2J6':/TfBpT'Sϣա"z0k0$uTAAMs}MZNeZBsynb}{~VڃFڧDm{C*[3Y֟\ɸ.}߰S6%8꛹jxZ=t7Rطl 6P(m;D>ʵE>"<}EjƝI%оo&3U3\?^}Rz=C/p/\&y)s}Ik3"8I'XۗL|2W<3TE.|*B>I@M38u?a)k9Avi@lh@9`uSbQ,"]MD){/>2$G# \Q=N\hUxn31^vO|/ܣcPh#T>rUVP8 |TX#1 <8 C@]\E)0et]5-&]{2Y,@y%8U@WO"C,3XL D MYËSFʙN)sF}1ޚ%iлoqa%P)%PZ;*X&Hn\g@!/*EOPBvw-aV00f(c oe:;ѳ<\ZoXп C@/irZ6 >^I%d)$aDxXL,0ީJ:%ph8?w*h w޵yU̬TnA {neDe ;<+ J#fp0'8y\Vx(Ya¥t]܃& 4dpsRz#,&S2K(]І6@¶x6v }V\Cc"tQ^TL$^Pׄ9DY-3Я3;׹g `VsHTf@}5UV$kt޵o囝Yi^5a΃(e{bINU tk̘hO'.4,(f7Dr@, zmmp VQ1@Ru)am;Lt؋h#fBYM &Rǒ~^>مƨw:] R,l Ԇq^.UfGRCQNk8p˹3\пW2]lR]W>A Vpڵl -Y0%G@ ]]EkeHDvhm)^'cA禜%2`&W#7 p:RHg,)^I7N7C6>*9)&6:v1ʑ?" ׾e3X~V\m[ץNg6D22)[&Q9zmnSSzf v!&6nlNca$4 Ny =}2fa,p`^90I%]|T?C&ͯ:Tݓ4`d hr utdؖ+$YNQ&FkPƙYp{ɐBh~k﷣- ^Bs W}\$4Ֆ;K10;4 ػ brk%v0fR B)bM7Ql h pDx \a`B?s!Yxir4m6AC6q`#]'@QIQYnsoEfAEc[mH7X581Z٭t;rV,d#*X@X6zjJÂ7㖳e4CA*<3Yr]Mr@d[VJ(o"/ȱ ZUTC2ih`Czr[R< ޛD[~a_ikgD{l7-*u Pod\Gr endstream endobj 796 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 799 0 obj << /Length 3107 /Filter /FlateDecode >> stream HWےy\n!H-r\Z:!0$G04.?$?إT$}=[<"M&|DFřC/XW7.o{]{{Gb6gpAa+z&QֹjKS}^J6-$Y]!rhc۩} "_GhWIrå/Lԋ,b(=z}~QiΞ雗o^@N&.<*RiU-Qx7q~@^*r޽x+7E:Aei8lɏމW*׭Fwċ;xw}?|oJӹ,ūFU oN5/Fۓ82yA;~ipII-*j*Y/\ۃtw~4M/ecJ]K:KUF , \߫s){ժx(K,2VQρcv.9# ]`mjѨ?zX^C%ei:8HbWkm9YL_T 2x5P躣s|Fh(x[}w$ 3Krmۿx_C~IF)Cr!AyOBHq҅G 9xA7_< "B .I*Mز2T\ qvBks*U.}<_A3b$+][K:8& h̓!BGTD܁A8+䳆 v"Ux[Sr՝N(9BQ-ԑH@4q(GQ l? \>rIp{jSm=F4Cie-0V5GTVQ4bwROf8}6E y }ޑM]1یg[$ʇu6t#$+j abkpng^/]4?;95 aj%XZ&4L#`l(J7 XFSGjl[ ‘l8o.M-X|lƐUZP%aH,Xf̈́#bDŽDԑ&`ϡ?z;Dvq'Q$j5mL]3X rdj)?2y,52ڣjIUŴˎœ;΃MuN0*U]h03;aV*ig>-VvuBGn2N@Y(F1GzŦԷgKSP]xraťNb,DžW ZzD'#Rɺ\Uf_44*MyO`qnHduHޏSМ,6y)ެeDq͝2;hbf#a\L}nPN8HGcnUHWoTSp[?/`\{lKh.ҳx.:JS&6Wp5aAW4[ ' #ל; 2+@b朸jA0̞cfdMlo_S-hw3c+~换ܥ7 ށ5 8GW^D+,Y|ѱ.DX,Aa=z0,)!9kَ*bP֦:piGhxyheECa8mQ+- #EpǬ H5~Ei_ƫ-'B ;pF]W~/, >Vu f 4]UK1m9qVsC bVUx^^)E ÝJ<\F f\}w~nH5Ɽ|Ut"f|U@xtXJv7;jit& rIqhvlrdIۚ:]2 ⦮Gr׍Ԁ{3>QsS3w,zE`-eQOF օrb= $e{؟Ȥ> /ExtGState << /GS1 12 0 R >> >> endobj 802 0 obj << /Length 4998 /Filter /FlateDecode >> stream HWےyQn ~KJdEvRIkR< !9Z1Rw+.UI" ^|C@ܮ/ O! 8Ez'vwqؘ }?%~=\\~pul.=?sv)/;}A֥2BES~Z^%rK/ML\^AoMD/Ŀ~k b"L2/OPdQip2d{} ؋0={Ջ7FN6Jᅔxd;H<<Ç7o;,M%ygA,0$89-^t^z#xjj >uwHE9 %,+T{/g;Rw:,,B/ s U~|Wfq . RfY8nZmmb]+cġi]#J Q! hLEֲ<_wK*ja‡Nl%jnZa`;*]?YaY 55Rڝp 촡]jm/ =9fvw wva6OxBVKuMFHs/~!;Q\Qln B{e/;o }H&Y}/"y5tv[\_G4~ޥj5dF]EpH E5BгHv2J*٩USr+բKlk砻- \wWxٌ+S3Z%+ Gݢ7>WbCa:x*O}[p[Iq՗\wX('{`#bP_YrSkz_5-y%+*S̔{BAohHpɬnD ,v% AeY.OłK4A~ ZU+1-WO|أkX/CŨflgEUxr)vYv.Iӂ-r NZ<,0%emTZࠟnS`CU/;71nQ>K3s$sl\mxNFvkb춭Rb/י:+4X,|r\RҺ)-EP|Tz`jk@-f04#'1u8?1tuo'{R5;`Fɕ1@}s|+i8вO0LRmߊgdg4YnBh-Ek%E/ݑh#(|1vbD#P(ܩMQtKPgZ]yZer;uӉ@ .c.~Ƽ x$xH3J/P %ƒ!:54sG$k=:#mRmjC [ƈ$5z,@d<4 Q>;jۍ7_P/0ڂHBƙE H] /"wslj#(uPŪS\pfD6 FՋZbOpOC4N;tmzɹ|wߖ,8?R܅‰ľ D8<-B%OC?[<ŰG@c+@Mj;/{@ '##vm; 9PO~rs iB+c2$@D&nˆRiy! uNfv+ /M_F'b}qIL#~0mJ^؟X_J [MV&ùb3KAnI{be;Hs*cG*4R+@ 9xI-2(jM#t Vץ[V[HgRe 8\qXKv?zo˭k'KB4|AuE`OvvޤኽEndUS@dž׏J'q5F9jB:|7=^k̀-R "5N(m[Ҕ mj CzQnjN JwKf5J'd8[,H2UyG'%\( a]*>qcRu8iOyH$4?U-hc ?M ϢXfLCjLY]Os]k܅'?gǵ`H<1 07v vuoɱx,+LniV].1y|:VnȞFv\q2L ᑖ)ѿ=EWf>2&WEn۪^Cѳ63 V[)7ƸKnPnu=X 8ۭ7Pn81:7oR̡C8+=h 3DNAt nV(e*!*gf6R 1ܨ ;_P?BS:ܰ9~v Â;TMSzB9M{j)Y5uvcǟ>0Kq΃=#~bDlXۮ;/nDGFxCrG|%cӝQ0*F )#:XN"Z5=y/@CYdU/4'~EwQFp}n"w)lQٻv̓*{EbV,y(eZelf{5 #pzRH yߺ'3ҬS%1 ~2U4p]2өFped_CmbE2FR-Z<%վW+f1;lW^0:kgŽ ڎFI׿gCIFn(R͈ck}cMxEr!%/a:H6'۟ZhyWb;`Š'  +LEy \ w7͸o{]dj[q3V&|4#c.Gc:V۶0YF;)2I~l]%r!ё JQ$f\-@ VCH4b{6NQS)nˮϲu!2$ J6"C* 䫜iKԚk5{CE_z9,G~&k|cʤRm+_=|G'%Cz@{z  endstream endobj 803 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 805 0 obj << /Length 4855 /Filter /FlateDecode >> stream HWnFC?di!Ѽ_+,v8F<}!{ft3lRgfClo4CV:uTų(b[m.*_*Ȣ$aEZIlw{xm >Y7aaV83vD!C2K̸=ћF-0 Wqar&"/MT)~"XDas n˂f^Z%(HdE\eT.z)(4YAQ$HkrpN.Y7ePqEXa67 )0 *ܨn^@GY*=7qav]@Nÿ<UYFYxooK) `-Z/KM#*8"znpٶ z$F/3q; c:*5㚤6Hf^.Q;VN BG+,by[-x`-l#`nO և6ZF+Dnŭʳ4r0V;ыSF> frԈ=:m =8 7/jdY3وz0G YD0_'iNTu3WS!>Zk@T0k1XtR\G\F@'Cԏ {GyY+mh# p1\ܮNb_+fVɍįB bs<,0ZFkPO"pƖ:c˂(SK˼rzwQoa9 ]V.=bZ(lW˜4(lJQ'4}49 ̱}JڞLВO5A3>ouw~ވQ8"oQG5 lȆύFxwRQc#dY)sģlְ}ķ[HRWm7l;P!R >"o5^ \NѠ㴵7_A3;=U"Thv8>hߋZvJՌ0h,']RV? ^ Pגty5p#w äZ-@bh… D{;M|bnH/֙֌侖 6p_<|bQ:FP%:eg-ǭ9^ hCYP^ \6֟Ȃ,8s{@!vNy를BZq>QK* bb~"Ko62"EL8a;`)̉#zeHhֵhE40ümI+Nrq6HЦ޻Qİ^s"6o2-vEF_ 4pwj;L]pvk;_P#-t(iC%L =9jN}ae boW-q&?tͳt:4+;_gfɉ#yw~<ɩrMǴ/YY@df@*xc]"Gj"9Զ)II/poRȊ~@7,;^I4r0qQ^Ҁ9~UP3yN]b$O MCYf=9ا-d)*UPR-s#ǫ3QpcIph`jA*3X~*ع}EɳykE6qhtobg/c`V% jMH$ QV=L&%.-(>T'z22@DQcL$M !LId{g9Ȥ3˼ڧ7l?ОSĚ\7evdFhTJ~8@C؏>v>9)\q@NEA_E=͸;p)/XP嚾(hGi_KWק9sf{Ѫ~~J> #_H@X8$(%AÚA8J 5ܴxi9@g%4B/YmLAJXu?wԃ-svTWףV05G2E0*K]Ǥol9%>\1E mQ;KLn eFήW{xr :Hh@ƺ=M{9Bs۞řl(D vz 3.ݰȱ3^XO7B(ju'4ۤ2(%c< zMo~^3,Yy* SAf?; aLҎDG0ȏg. tʍjqǦԍ# $A8`aOVj'֝WKֈdXqbclb&dp*Uwp}cH-4 -JU;  8d9Hw7_řٳYoPmj{J%޿ècmbTc9̒,NQ-k@sHP.WYc !E7Y2ehZ0 6ּ^]#|y-Sվ:K8nptY?wSSw#[Mw՛J5Ve(Z] nDۅ+u cH|q`}9( nى@Djo] AJ&%,lf c aQƌZp;ɜ#Oe#Jrz8@^{3=QZz>h`:O\%u3qg sn ##W W6*e=047>#{2A`W:vrJ4闾~'s$(T5bCb6Wgp_O%g~᭐"ށz\ (r ;_\_Ԑ8XoHXP~o0t{N{Z}nީX?eUFGxQ$n8PYU8mn/qtΞ> /ExtGState << /GS1 12 0 R >> >> endobj 808 0 obj << /Length 4838 /Filter /FlateDecode >> stream HWrۺ.o89':͋_ Bv?])Pv</k~yS-77 gyqXyZa:ٲ ͗{ym5>Yo C~}W>f-4 עe߄]?TX>ao?Ȟ-xq[} eQE"*2z Ginn3m=YTGQ-vmh:^VU 2DN )z-2|#ZؾPݏ xSRa56"9„A^]9"۩~3z益o_5qVB4 +tW;QL}5>NbC2 ˍ7UYK[ŚFYWh3I6M*L"c X P8kj/E3J[ޡSV dxG-]Kq"T+NuEjy𘞋?g x%h{ktHϐ)df iQzКOLl"Đ*N]_' E@TEp"1}nt'8;R>iֽƉjZӐ>{)J=x[Ơ(HFochQXD%430'Sy ^%8)ϲXZ޷Dܶ dGqJU_X_T0:YРVb8|ބ(=(lJhe4=`{Y;x4!IK %U#h*m^;4nJr1!yuݎ}vRl+8Z,7-# g= sRCchdמ\g[?5l!v+H&MAlwPaײi >ddWMlWMM4,OP$Ib[+6"wV+[N0YV5"Vf&$X JJ H=FO]{A.!rlՊf/crư|Բ_w˟==-wB#m+q*6MmAvI@0:ib#֐&թ[nhHJCVDž3JF=DJiugt7םM9b-G7?c}qj!k5;#=΋m6cd.5"[H5Ν LE>qFmâݪ)T]p+vjlݵ )#9M[EV Kœ%mNA@&/KdE׉p7*)H4HSbLJ=ָK nN4N$LJ֯5ˆjp/0Np$tZ cvr{n!1dקFARޘ%Ii^gF8s4U7=[ɇrTUY.οZNOdA aD N''~d%. 4Pal⌌n]kil]`L-<T!ob^Ů2 S (ҁgS =Mw}y̏[5vQx|r.Ypp3Qk=gd Gv^h{pkF4ģ89CN5\%—81 SOF&̸T(i!bhjZgo 2NN7۴n>Y3Ty;#[mx(MƱ; ;hYSs.z9֠>؂7PO8[IL9{ߛλ3W1l2YHyj.5fY-&KJOpʄr"T[CXi6=9Â07Z^j@sAkU%\_yEY-qۗwtuu¿_{~>:Olx|v@g?^bO‚wmW$㴖55!tzI.㍀j'W#Z&#sy&ķ֖nZ łrc1@i-w'"g_kQ=;eE2Iqg 򻵍ho_>?LlZ$.0+O 1!3M@K0êR5V+{C t- 4rx;e+ ܙN "u|I=1m#؃tM+R#%IGg04B~[IX£'#R)#$Ө(߿;5i6y`119G iӬ<[&;,#v&ƩIQdi1wyp?U6DЏK6@c;1$BAI+h6as0'La?[=׋]~ ?־nen1=T;]bCLꠄq0>~$Ȩl/uS\ZGtBͽP5DZG}"IT<(9 ?B7 Y)y IRN=nwϫD-xǦ Y'kK8٩촕G4=LCB ŋnznrM2NjMgzrGsܒC]SG66$>J.>*l/Aq`c+RW1(zoLQ#TU,Q\ՊvVdDQG%WrQ찞l grMKi5YJ `MRx}_Kϩ]#LD<3*ŀbCHR1-jAuzU9Sv(b JgӪm\ W q=CvM m@[GA`ӎ#7͘Ak#,j~SaE;6U*wL+df]>q0}KaܔVx7-ꑐ]ސ@VpյUܠuۀ$ޯ9 y֬:˖\? .愾`yqFT^7켛p*:zAȾ=N U=f̧5zs1WˌfK#%n> GMF n?!VNu 9s7,wrSHC#pm^+fm&>oTIǾET*C}~E^lqkp9$g=yj_l_W^>;?(22. |'/TЁBT[0bd7YgRwo >j;'F9PgHd:\gwh_vy_w$.Z"tGbXt`Bա$3KL sĄ;'\>`}\lQ램<+t+W9!%y&쏻wr2V2}ust$ag,g?r0\{?bpM<K {B~uw"D;jmQE{&~&ensnF̀/D֛I>zxvA&s_ctY:MjSJbsL<­cnNs*{x5 Gjh?Dު(ݎ]nYUs[2·z4G$2};vnWC;Tn/LDz[m-:L{>̚/BҴ/c]+&8ʧ-P: 2s'0g?,H<1ܚa4v#S#l]9U\:Z:D2S b+hc1u;M}uiqZ*ռX&]sE`JF~'[zItX pN\Fd^hxv^4=rexO T!V;R˿U ks(<_c+3J5w(kSt7@;> _0pF&qw' 0=> endstream endobj 809 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 811 0 obj << /Length 3180 /Filter /FlateDecode >> stream HWr^YyENo;U7FN6Jt6ǡK1^K^܁Om]oeo}#>f=PRUݻgYA "~.w艟U5JZ2وtWY]߾ki~4˼"ȹ `4?ٞȖx evl[Z ]9"(|o6o J\Ed׋}63R| VG1t+Ktثu5-r'$/Z7$B<\+o뭄MlnxQ(Zoj+ ժMͩ9;ه8jr._~#8/Z̼?r2Dl!Z.zY'HQFn89AwwJ=ƀ(ml8t%[ǭ%qȶ7FnHͯDr1=Zj#=ﴥ1Th/ gvߑueJmadK^SUiTl:~h]$PTM3۞#ܒ#ᆡT2GjHVr79Ѵi +qr2@AJږ(Zuى|"; ;T _^|ضl[a(E"?PV]itKqֲ:v ΄7'a<cDo) (k̟NT2%V[%N ZcbF;>hLVSЋYk\n<& "aڧ;{-|JW](L`ebzJ [_Q=wPaGbnpZng,L :MNi){%kXPgk1͞^g] ئUɽ/ph2s^#U/ -.lKY*I"oFT)VD[rXNp'!ZO)GUJhYjg^-c/[(Dמܫ-t-1,m Y#7/7 CUjK(g VgxuZhAiE )Uۏ_]u^2,QM-3d138hW,Z[uk7n0X RDK4jce|@fc5Q|G6?Yj\ gJvw,w' ̗Az4@U%W0q<͖!VuɿoyJe8 !'H`,0|)=|Ʊ"HV4twUY)x02.<ƜamҜ@_3c"%y!IT~> /ExtGState << /GS1 12 0 R >> >> endobj 814 0 obj << /Length 4333 /Filter /FlateDecode >> stream HWrz@AFkc'*!nPT7X! =*.\ǩ>/ʔj7hqXZx"Y!0 <7PϺ͕<;Á,A^ďJ R|R]}h%37Qa sw SyR7(i);lIFՂ, t^Y 8_u$̨NYQi*Wnß^ IQ(+"zCOrW7F]-ݔϽp^+)ZA bjeMm]^آ%⋡W+dӐ锑2gߩ3beӨnEV&5ڨ'+|VR,Y]Ecj.S>vQu5m>,V IWĜ<$A/1x@H#E 2eJ77g*ԋQyv22I̜$ҊJ|;YݏA}V #y *sPFy|ATM_\3G8N4@Ymk:M)"0si$KPԏ%>И3DKӨ;BK/V(".V!Ց~_ڸ>IwxFScWշRÒd[]ΌbJ\<0+ h԰1UZnޢ..;{(uѐzVrFAn &gv=jP#:?@j'^ lˮEƮԑMndf?Q\hUվДqJŰy2Bkp7<Ũ'_cG^f%8ssE~2Ss}P4C= =!14O.5;C4{gC$i`BC'KѰ,y[6D5_{379^4(\u;RWu>1rm?5:(ʾ ~p ArϚ@4-X.zOU*h`Afi] ,h{#_MRFIC; +9`T-huJTha;qJAȤG(<\R JNLA I++S]$k$>0E`a٫~D+]N[.Z_MF[]ǒ1u62@= wi^.~Wk#˳unzm;eN\G;$˖^eٱcߟ%c[2dD-k"y_?LEeW*J)#"8u۱joHHb&_"=svΛL7$ٮ Q$^1h;jeJ>fFs4~: ]AQWkШ<ڋGV{(D Kb)JR$(͆-'[ڌJd P$*Vlc{hitfHJg,VRlSdu(Nd0޼R7 `!R!6b ہdr1% y4YTwuիoأNU6y` P:wVAKᣆd04Oq8A=k>'s׼Q8C#x~9tYh $I?.kXl>Xə8w9ZWzm"Žȏk}vES{ͪd,/z$HsQ37c!L3 'q(7nWle2/6"ro7IvDt+,l˽ KVAA?$:1#wF&V0|mΝLwbEt>Z5e[sv$%` aJ1z?(0 8|lKfFp駦ёnnoH{H-5 6BgPnWäIS_!U6L-JlljXv˂;*d @nûq4㭜(.gEg4TQGUX`&PF>uiq1>5+5'Sg AIRg0Ng-t181JC!\9}KPhd 1M%O3 U-/EAN֞Ѹhf:ʱN+r; QƘk8!*&~GʠS+\m|Ʌ3N0P/ke:MnHb?$a~팧W| seѧ(O z˼گfG$kLJq\6>kZ&l5gȳ۽w۴  hkzs7xraV)GoX 46JȱR$(iɖnKπ^Vf60x&+(BXtz] ˻GD@㢛6./4,5Xs0_%s%ta랋a ̳Rŵ;=<14[Dc*ف}S;m(Tp!j!mU6+'C`@l<ac,iV6E.M?߽ v.3HXd/Vg*bvnc(KeZ/[ הSAs5Qʾm";Ԧ?K歁P-$|$ ѲZfx=Ù/_=3R88kpuc@sSʷcf&@g_Z&n;D@fk/gwz^{}<%*ZzMge/6V]9i)_DSXU5f8 ,7,MgoeY[ϫ/e-8:` =p$]YƪRsˬZΗt+댬QRm+^͙7GOy8xA &ذv;x5F&XMEgSTɘp6_,.> /ExtGState << /GS1 12 0 R >> >> endobj 817 0 obj << /Length 4588 /Filter /FlateDecode >> stream HWێ~͛n~1,IzZdKjfؤdCTu"ƻ fF⥺ԩS<ܽSH<6"F`%X Tj/t+>(YTT Y[SYNUğT{}?&Su[aAZ< 6)cy/rR_jh يDKEqخKeV%´XHc죯5GǤ*mdw:OCvm <%Loh@Ql;0u vBa$4Vy wn `UNXdk ri퐛>LKAV73 6VgJ[Yh[i9oT 'AX݈jx*S_IDXMc!TQh`MHΨm: XӀH5n٬In[;Bdk4 )5d:t[NJlտ2Vo?# |ԟwCb!T,h\4u'^|5qZCG5mAiR5)#d>Y^MF7Q$ ]ա hJ4%@d'im`kr"0iw4F(aS) 5n|ujceݚ@EC>3!;"N|LTQz^:j2Pg lY<{Hµ_kҗ؊]/VS%bҥBc>:[.E'AId&kJtsKX'(!:IHnAiP, Gufz:o`mѨ_Mm]4:RƎg*T gF&4ƺoT0Yd::N&g:aţRJrde&Q[2(l[E2!z_.T-]qL 2-4ZށWp{jv j+N1<|*mVQnyy.^Xpǀt3qQx*-hJ&!I /P#dE|cWPv6Z7JLmkQŨ1ll:\!Yu>% vꢢ!"l` 뢪]RkNJMMxn3TfNN~f DSGYz3vo SϹi3Ѹtd{cҝ+FMovnz!jȈt_Z9o>烀#,xJĝ>e~u mK~T9SZRٮp'kAߓ plt'2K9Ax2?LPNGCc)ELgT,V[TQc牙 "J 9%|6☀;l@6rԱ$r68q'x}[%*]e&ۦL%$Lj-}&C-/.˼#|N~9PꋿIOKA2FmT9ZNL&7L,t? _^ `TMBmssʱDxt90YBFo` x#'1gpqn?v42 DhAeeo¢qb&|ULXӃSR?pa8%/uhIn& M{PxKtW)u\%0ÙWNsU![:~SOtD9 *KmX5XH@BjyvqHX x]Ktriz)9T@ϽZ1 [ќщue^@>[>=٥KaxqXj (NB|gbO(崍0}]uB@\ig\e{HKZF`?Illw r˫D He9`XQ>4aT\{-~;e-Aթ%vT(St(ތ_3r l[3Z} Wv2QrEOBa T_A0%KSm>@#Q?V gi虭&޵W"Bon(;bk$ndw΂1<|{XCȜvC'0_[QS-d3fA)ƉKC'ko}hTգV ͅ.Ȇ8kl-t©Jhܬ.i6y*|[5 &_ʔ|ʻ["%ΗQ|CRWxiМɴע}MIժ0_1$̐[{0Y}&eki/7Lrͱ`%q[(&VÄ6N(2yu߾ V ъ`wy]qQ; Az\!1Ц8ShD]K= uu"a`/ YnIpZ¤HTxu&M[(~i DL;NbAQ-UD TAEÈV84'$ÎfTS,a 7I?: ^AH]a*j@mFF˙ũwim}Lj>a\z*M97:rQ+< ܢhhcA3cW<2?5p\ўhUfRшA<FJK^U"G]78Aq 1T#F61Eb56=U[Ã?&4hN41B`F| HO e Aüp<7~fT4|@LF\У6g6z1 ecsTRZ#jHv;sw0,FM[SuzyHf<&LM!+ Y.]_0N9zZ)rUJlׅh I#e Ue ʒݨ,nv޶P?xCWEJ#.&x,.{#UEBAhXJ2ųNEsl]9:lW'vz7|Ĝ Z30@)ba #'vWVڜ9k8F;'ji7\>5ll+ 4ۂlmSvˡ{)x6Dk3,q5 >> /ExtGState << /GS1 12 0 R >> >> endobj 820 0 obj << /Length 2430 /Filter /FlateDecode >> stream HWr8-!xg^ĞʼnR>@$$bM*^(_9[?{)Y$[3$q郫jJ'&nH#ze{CŅsJ5Y$3۲m?]L.-+^QײۂWלUIF&_dk? /RLc  o.&/c>a@fԊiTtJԏnX#,n?~md-DVsL}F~V'M"W$Jj$m;*m9ΰd቎aUS"(SQkI6k}X Km({:o4%$a唴e @^5 'JbvR2%9g)!Ds.)vZ%VHkHX*o*kJFDK^3@fJCq`nlZl8zl[~!N8|u(fD|̙[P8A.9txf10)|G6J?>5ϷAHJHDF.jH,"2ERCT=jsMzz4|e ƨPBaԮ뚟 1~j8ƀ&{ŻDvD DR9PIE!JE kS n-r-ly2#gFJ2UdH+4<%Jl6N>L ,$x!ZǚF`P?*DjhVaJhhUDN;2 5*&fI⃑?t ,Pj:i2x@m?7m]C+,u&6 z{ { ;)qH[zLQ6lH 7(t[i>ԝx4yA5:x_ "TטZ-?`~@ڒ55wҏ LQNdi (4*հGp ]F=H^?dO~u\Ս};׋Kt"Lo"ۊ# tGe8%z[ݵGrYޅ=Lh/d2G<)_LK!`k\J-SWz_Q>U_b@8JZ[MrM~z'g9sLν8=aZc{CHsIfxXLtɶ*U\WoF0nLu&livh12ACqGi/*\B;JOyXQ:l>O\|\}xEpcRmK:* Vkjk]5 J-KЋM7=1#zR"vǔlr3e"XnqaYǻޤwI&sލ{V@i|Sm שY &|8So +V-YȵE޳4bQwdtJl8TkzZE(4o,¨ysTǵ(xnΣvOk“P{! B0~li@-/ՖVOYJ}[v:90aQ&_ny;SW{uSPT\_!asYx݂՟JM^?fU,[-}{D~}aL,U[PxJwݙušwQ : lddnfEnxQ𜅠XhOc݀;!|is2h ƅGS`8?rx.TN=jZE\%}o|[qf>k\dʻpMF}! ;ӕ{d>ti)+{cxLJla{4xF`{Ik]q3bl7sr֗>F&,ksPm# YDVU[u%^ ޙyt-B3grY@젚XZ@VSatJ- sZaqi0G8g#h<91oKd nzɘXr"I#j̤%v, rEqs{4\3g Yz9Rʴ _ʊeJT咵SEy5)ьڥێ=Jr^|, 2O|FfɎ=lRlӮw7Mb5k'>ZH!r3:c+e?S\ ENXgil >s B.:iD]˥lr60Kv<byܪÀW{˦1ɨP71OI#;,r^\Os endstream endobj 821 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 823 0 obj << /Length 5179 /Filter /FlateDecode >> stream HW[]A>ACc O3iy G,IXbQfGv$~rn)TѰXĖ oxa,Xƒ@A랭$"QA}Bcr63 ţt5A_(`\WN\FR*DU166 5RXj*jG:Ha¬bJGqBCQc{mVY{1@KwTv{.x׏֍hQIu'\cN+n4[+Y ضT?&48E@Ҹ5SOᇥY*/ Ro ŀP02­+*4DTEDdd э,i*}"]3ՁѹRduG*:jUU#dM[PV/Npc;p5J7 OpXirfʞbI_IJMR20"Ku"9[T|qӂ/6<}R4AI-D6˜=A8B`#'~+L0NE>SA8;[a E*@ `;COÈ,X7X 8>-p}??/""M/&$OWlܬ1*oHŠ;`K]wFd<Qy˃ &lF?oՍFl%ϯ'6r: [kHtM<:ΙbEP㻙5܊&bph쭪$ E!l 4^j^udz !`1oOR$kYGJ0'I#wg^KcN3B̎_bR+0##b*Ap{FT*0tS^ Z`VrF/_Y=y3h3\{+}@vp=)k, EϽ{U{0ԐE|ik i_B-Ăŵ/m#6mN{ާ)j  z*{o4Ӯ N3[ ~[0jmEj1D06hۣԒ"?a|hr2GvAN[i`S-2O@/Y3^u{Ai i?4DT0jyd=X-Ȇ\o!uk{m"ٖ'M \)uApf IG[R`% ScgϮŘơyJ8Txiz?<BD"$5M=H?ߢ_G+P1o"`$Yt=ҹrU}\BI(4H">XјV'tP%pS vՇ=d[ lctg6^ "橅 7tҗ[n51a_Ⱦ'2 4Jc [5'y$}[W(HPQH %aJONnR>Bry=jD!kZ^V)}uyjXba(M%SdyhɭD΄CWuܳF;`p\ F//8O'yd2<>clWw^n \&D49aX<-FkA-U +iC\!ƄXy ܒFRr6{:(:קY guG0>^:Ax\Qd102¶I VeJ+Ygs4<|IX[tlE-Keim!u[IBgZB󗭄+ {\sRi,a6_\jWO571JQ Z5`,j櫬H8uäkRa0ɱIRRIgB^L{'{(Yza4ݘ:0Ӿ C+ZQfGlһT!Z$pݘ3i 66^̽l1 cwG Ȫ!Yپ]UѪUU9]CU | vp'Bc81, 퐴jq}١08*}ACyoj\ա\]Hsܕ:Ȕd3znY@F 6>g/'Ѣx!5o}~("D'QR3V!DXw&?az<:F';KH̉'7Xn7g-Xm*1\ ZXj#QDz|&r 8`t8jrxv*RY!)3QR_,PmفuFawVSr-BɹoB+0DxjkAl]E_{!wyGއ|yN'18*,ug܆[USʨKB09'ſ._1б2+L 4"Aeљ{ž4KtO=Uu"[ ܝ9}tm\_aX|绨6XEx38"]v޺ 2B#ed ow_i~\P T?Sq. 4SwNɣyJ58ܴT+J(\>nKԡLS4g'W ,Gl,ergHwiJ|'TKF;UAN0'xHxZv2 ֶii.}F@Љō1h%?s}rBۅQsu.@Y~zU}|h}A.:B޷.>Ds/$&ogEϟ-1aO ,0Iv[vN,PJPj6oAoF4}4L*QtrJ3Gǻtne`0N#2%gs/{KAE_Z< ڻ_zڼ) 'h3W8A:'_]* iӝwgyK2$©E^bG8M8eshq8l4n+1Mߚ 7 C_\}ҙ+`JV -xx O]ܵCs7BWaY XsnЩ f` Um7E, ؁ޯlT}y"UZjd"|6joyHWCMX'o*4>Y/ͬ/b0ચgnvTѤHME,N~? p«l# G˜-$b㕗SEmstuЫWIA;= JZÁRy & Cn*OJ'I@S'КD SX&0wiEtU4[A`'Z/cAs\9V}`Uɲqzb͔ }lXꩇ+LWBzL_(dN5]GR bdSXB>^n8rۈ `PMzH+yaB^h\uoCPVևW*p. endstream endobj 824 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 826 0 obj << /Length 5617 /Filter /FlateDecode >> stream HWے۸xlŕ'L .JV>"ߖJ*(JT8T}~Lb]bYV&*+VUewcž~%a['28Ϗwa՛q/4Quc?X?aoN''䤎2/qwwoYHbU2*5$yNnT*m";uå5>ḍ*/‘߫3(2狣z0hś.j-"Jʪd8Nsx236alP#4JR@,5AJӬ`I]>XBO(اފF\UƢVhahԌr=,(r~j.:َiO-ʅ{RF ܷ̎(;K7#UBK`/z*+vCdH1nKiFPO|\"fU;{\&ԔVu~NqY{؉E)7+jrX|cψ,*W"a -EPiTiBZqf/瞗*A;{^.@֡MhvDsY6] E;cSP@$VEzeh9~gj ߈7 vɎoA  {Veyٶ`!~'N.&<3 hCtL^ i\͠p{Bp|i˽;~h>h\6kыl_Bّ9cOjzzNmO$}o!:#C4R㸘GGqqxQX.;0r?wLpHE:0\UT굿ZZ 2yF.I`#ps/1q@fޟ]䢢UVqŵ=->- DZ\Qj c71"~.2O$"Ÿ@8×8}nABNތ:xI+aIeaYX"%qvpm#-,` ɉ L?cr!RgFzʹiiB9;w1ю;'65 ʬa:k v,)~֞zG Šn@+(f3S,lf$x ald]CG«$).$-n50i؜Eve%`Ve<5+@`OÅcC3J/VjެƎ?( wì%vZnAt]{$l{On܉^a8Nm]n5:Hq4~ t^OwǜJKa qi6+NE~mn"$S 8Z=[Fi`vrcrA=yd !uXHH'2#v7(y^CR2q "pqg4Cr~jMJ3Vfu9ߑ~$ҏww,T%8' &ug.]mgIOyACd+d$_I&3ewjb&IJ][߱M4ի0N4qg:;k;DYиڥz4FiϺBy2H{U8M•ʟi8[5ÄڥSȪ,G`0F ?-AWh9. KnC7cԫ^c{Ǿs-ƫ\sOe\Sv1]wFGdwn+$cf|qU,ienD132eq;S&XIlGkWO 薯N"(IˢtTBV V9q%Mp' Yݣ蝱AS^rmjU(Ii;-gԷv"!8`܃;eV(aI&twT (/87t9v` @mZ ۉ}~Z}z!_ qܘZbB vOZUS ' ]|fۧaв;7pۨcXw3=}I]_Lk겟=AARb7_)\M>E ӘLt®y^IU:絘3{ph:x`;=ǞiJ0ye]@ `N͍YjF>ANteo(44џ/1|GkOKGB7p(H kFWeIzACO&9O s5km>#ciw"#f46ƨu[&YZrlѴ熂oG!^E7Kbɒ+A[A3!A(Zgd`g:(Ja횂+F<}1OA C^駕뚆.[co-ca: Q xRP%:T7K5 CćDYu!TN) R7M}?SX5I2I}e+DE?{1Bd%6r7c,\DߏdKU>"ա5|w8&ۙ}& iAŌT i.aTzp?$˻ pa7g<U V9.b}߲)+\?n3JdV >[΍0Ýgr!'S`uRt%oCrʢ`%~jqV1;o7Eou>8(QjIJ~xniiUX XTEhd(9i,NJWZNdy$$q$QU6 NfC2T}`7Dw/}\:bJ)0L=8ni|K=@?X;DRZM0eSzkqVtsu@uߍREOߍ$[=K`2P`,ORɞL^(RWC5O$'ށWCn)6GuVu ׵3hx[ n9C r6e~]a-0*23i C^re}5F-"o{ψRZFUD&ea2ۼ&wHKYU? 4OPduBł-{jಿ0I|n3kJ94Зn xeT>w4W@>YOJ a#]sLɲ5%JO,_IsLd1( >q5&hee̬O I󻺩: VJ}~1;uEB( VkDxKnjMoi˺p@'iQxb<;XT5eR&+@iɄcHQɃJR@TϯN^u#Yɔ}Ȇꢪuk=< zC?g/3!7iI:sFo4vG2B>xnCsgYOW/D'1dPmfs=|" &r4}0󫙋۽o&D e D*ˎ?W=_!"u3w dZ&9>TNL% d">2ckQ>P4X jU3o1YGx;/ώ9JgzYQcSM$ƯOv~WjjE3_:.',A azPo@jbv\"6jf0@`CrXw ؊H"4iN gPA2ATm%s`[y5 cĥ endstream endobj 827 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 830 0 obj << /Length 3871 /Filter /FlateDecode >> stream HWr<) Mۮ6lv#`H`1% ?9s PKr$0=ݧ~~G)d$_NTxK;xӳ!,.*m 28i0Ay3lP*Msьz;`yU;$Xw5o OFCS̛<F.2},xjAp%Y>o(+,Ckڹ*=~`U%WfWD@2=%ΖqihMӆKJǠaJk\v[0^nS OhB++V`-'ݡEmPi .6{##Th-͍*: j [gFpUUx도&.FW`i@x^NGLw ɋ@å𼤑5y{%Jw!\qbtwlT\ZO ` Vg1;}÷ʉ7 p|G B}F\aȁ]ȃcbIggim*ɶQ] 7h=@cSoV&w1y n6=Znr^[a8~?x2Y^C>F\n7HenHS ZEŠ;ctvynקd3\yj7מ-,(/G)dݵ~H)`Z:)sa폩uꪟ'P{}Zp <-۳d0 蝺Ǎ->N[O(?EYvb'U"YYdeҔi>uñmNavX|RDio7t\if,X[P88{Dť4rn4_X]Y$)l]?Q W#iї C;2 2[&f$0eΗٟJ=w wWb̰U )ۀ| E =_W`D ]X@Ոcp:[+3m,^-6 dmu\_OH ͜8z!HNK&0dn=@izjiNő6EO^)mh$򠪃' -l3mXK6iWgzO?=w2ӓhv QPԷoHq4$3޹‹/׿\]FQHN,H#eiDsx>Jħ2@<[ZqYMx^) .ᒬp.[Q ?>fV Z8&:>j|ޠޣKHgRJLp MvfmYLD;H.[ƚrFV g0i(Ͽy7 Z\/a\}đj,6 #YaV3س0^Dx^/Kca';7}T12Ncr 4&p~Ul(SR)-If3#od Ns1Y C >> Ev+mDdzk{ y CR!PKqdc @ rW"N`Y@wʼ ecs[.W̒RI׏ă;HGn ݩߍř;[!4ZU' Dmi ö= E+g.ϳjM+p"+Ħ;y_98($n،,7Dzz\lvZyؓjקRY=ϻEzݍ>{̓wt>Af㜠 H5X$ @ u1FtySEͯDb\P|{'Lە,WD786|EGֳBoRtjF2ԘZw_W)ؗغ(vt[/8\IJ~uJ aR?z.6SKKtSeYsos~.sUTyof&0a5B AܱV !_|$i5~.DRW]&^&\1@8UU%י3HBUnX+5՜TsnpǐofFvv3}v=0l6dG=A6̴WslrmB(Ve.cvqze}=v A?\yiZc31g7YI0 ZJ 3k1Q- - ~Ȕ6`S6J-!J3 m,Axd:(*xSF*Ѵ69JmDf) sԊU顶>1$˽)s*5Չ5o.AgC~nD>IbiNK5̈́fIէ ,Pp1hUu|(DۼRQ o4 ;n9X`qPBn{@DTwsHRf9ɝ [O[\k}NO 5 K2oq Ԓ>$BDB C|e|gҴ_e%\"E@^;zu}/x9Q/pC>-o:=mzG9/`!Vy endstream endobj 831 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 833 0 obj << /Length 4251 /Filter /FlateDecode >> stream HWr}f}C79(H8B^ [.`o~ V][ntqη8kwLq4B(&mT_ %xW(PVIʖ~hbۙy;UM! ˒,diyQGqGd^l*<\<{ggQpITJ/:/W#?$M>~Q8U(ӧۿ^#XD^S`sע7 )EWetϫk7%;~mGl{Ů`DTZ9>, /SdId9pxR Q) x.MWH_xE F?N:Qk2Vh'lC۝m&|_O+=?XUj'QQ2?7៤1vѲ`\E_uqMbۮ}jUD7C 8kA *mz656B1K0"uSǮ+kɷC<ijBS=2$H֨ڎ8eGV2\A};˕A͑ﲓF3`UXN!픦3BZ4ve#EUkG?f6>_f :ZI1xfsQY_w8q=[:\+Ų3pr[4hT=%f-FBb\&iY39' 53rd^ ,C!Z_i|sxS]Sl|=6^~eVq/9)DcR`GlDeUtAX~[NKZ86~iwapliCMfZR)5mFCl5^8:;|amHu-ufBMEevÚ`w ?`pmȧq}}4\w+BAyY (ch6eڍ> y%nc8quӎS0F/I3AaƲxta#3N=n53riP'7>k+ȗsƶ+@ۼ$R g3>&v!+TQ ˩kqhu>Ru& Q kWlvvl\ַ`[̴&PK[ɡkB%ȯiBNl| Δ,!їǦ}BϷb&v2 ILC\^"h'm7 \2ML)g<״R'GB jbwlsfs5b:“OFb}:yBYH.F-[ǀZgO2 o2Y6pp*17CDǂ xBm'cUOc_]2 =kKsy7i|0COy"F-3a17;Ag>UɧL8oq>g MkM0ہͶTv|0Wj,O6Uee39&H )yC 6*hu ųƫ{CߙѕHCzt3/ItY; :󥳜eQ%n.r,a+ܙ (jaQ̘N_jي` m>C Y׵݄Vvͮoַow6Ll&HU2Op?;'"jzqݝ[{Hƙ4*#v61dB(b EPb͋+I=3.I'u7ˢ3g. q8 ڻsGäވoh%%}"GÍCoh %yznT?JؙB_U~+Fb{ U-~.G IGJ̹p ]Wꭂx=Hs~lDʈEm.!kRӘd|r=_&épp??TȈٗy֜C/n6== SƐ)F&G1~ī)X!mǫwRepN9z!;FnXizprioUP:UW2RA_>).*Bz႐:9RLU?-l`AsMR.jW$sM$ $K+5}k!%I"ڊȷ+iF T #wtzYTẒgMT8iB$mLZsHu +C|<^\HO9f9:=qR( *7R2TG_V;09'tLCq;GE<۲I;@&@f&>x&6Þ(2͆с^MxY3i/6/^3}qh~pZ5+1Ā !tqt JFu endstream endobj 834 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 836 0 obj << /Length 779 /Filter /FlateDecode >> stream HTˎ6CgcnX @́6w%!);Iw6,UUzǟ&kӧe( h'Vnx'Kot}sN].rxs 2gyt{jMΡv<)v, ϸe,(M2><I[V9+ V%'g)(ogV/tbOI"O~ߢuVڣ;qano /٪be^D9y@ Jo"ÀZxܫ)J(]8ސ8&.VUy9 0? rR!X/{q0rO̳pl9:(=ߡ`:ʹGq]T V@1Ѱ)q~59Ys/R@[!Q8fWLTM&/I洛pʖ7AXκҥ=9? ` }rtP>Dlu[GPp?sN[tP"ڀG hvwךհR7xXZztLQO>%3֔Sy-+u )M-Gc>,3'"v}kRszL{*h5~j 9Hbv !@z/_w+6 FAns9FjR by~_M6e2X8` endstream endobj 837 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 839 0 obj << /Length 4529 /Filter /FlateDecode >> stream HWH}yPVo*L x٢~m,x -*d$s=w3ۛ^EQ~jxAo^@y.ؕЏU2W @Vrfn.%VJvX:uLKn0;&ۺM2Ds'mݺ1aFkϝfQ4a+v^ux(3tn0jH!7-h ߛ_igrEp}Xũ»ް lg+Q՝-ВYnvS/N6`TsxS۠>]m2t=sn5V&`0l;E]N# 58 x<)WYG!>GW&J^@bj 9)Ll.-jv^MGa:Q[LS+ pfwl&uAb0.܃ 5s9y7rM_H^E |Wc!1,0ղGY˭L5N^s>TC (2 twe*T2WPA$CR9XjYUgXeJI\W]D Lww]d}g` [ZVRPo_̖jWձlp"*~#Fp ˆ ;C6 [hv5e"G6c F0G0~ u9#ϙzKvcZP_dʦٰf#D 69?Cf{im[j;ԅ}geؖϷJ`oPtU)oPk,5ƱXx0'EYXΒ`$Y?g:'ѢZUžo{{Q?rtx”rgn$r ` V0Ӫ8lBJL_W,5eWvR >@I<vņX3Qu.%Ǡ^# dï^0,~L$iɗL2UH3&{ͰGy~]qh<A̾=z7$O9Moj[[܊,ZOe| }#R}#+c?T>G}>\0?(Y=[Aԏ (h7PF4Z^fO/|KE٨BCr&|1T)7vAD9۔UcT숌x! f-)R!aU.]¤{>{:T͖;39}XȑY$T% ZVa  -*1˓<}iÉʢsȣO{fg R ZOMEWcrMyq^}h,MSuo.U`kY2af}pxHc-,e$eMʩ G/duMT=q|q/<(llg .8t\ B@.?8t$=uNwp,x(ɷSZ@g}FDG9V*RZ98*ffb˽l}+θIM]|Ɇtm[>-G\CU4!U50QY>>UGQ+1 F?A-,B}V͎Eo l$FnW8v+3qK.ًkn |Zn%оqsn&9컈d;\kM͍c%: cƹah=Iu̿q@%$C, yf:rq0BPWqp8c cfi&M~zCŌA^x֟ `tU5z3[.e_XُfCrZLkp[+HhnHJf1᨜IڱR" v# [W%iT2^`U傦xjb gsomPti W3ʪTT)ggŸ `2}y[T*8F]3[RȏfPBqX& ǮER&eo!Hg4E$>?5`+ހcb>lŢL<_7p?dUHWfu3mx$lmUWyC#:v7_b t[ظgiq?wKJ!kJ)E>z.;I:FذH OuF*̓~r&cی&$',LJ ٲE/UʒEdRB ;ċO!io/&S74?jtxd p@~7 Y {pjck`'I=DhJUn^PnWR<pfN`׵Pn\nfUgNVy}9a6c2j/9pw{HR6ڣ kk0g;XMLc=POpH,|˘ߩfN%H;b;[M#j%( TѪ;S{Hg6IҔJ&|Jeu^wzla׌6^5ޟмj4G^t'x; ?I.. F endstream endobj 840 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 842 0 obj << /Length 4633 /Filter /FlateDecode >> stream HWݎ}}*B9s88mE.%GmjFZ-}ofHn- ]+oVaaoOk3A2 <ݻů;ѕ;vRg:Ѱz7bbo2^K'vAfqqيEǩVe+#hN]]‽4Fl%;į8;Uδi 8)=;d4S`H}Ρ} IJn[)ްC# 6bmC5M8cݮ6~͊SʘiJ&|mEY^u{SU5 u*V(l'&R2)n&a.6W ;4 -lPOc+bGٚ]reodEwy?0Q:xW47K?AְNqL;MJ;#6/JI-Y+lQM˅RDAС0i\/?ɍl*|;/ N.N6<}_vbd]>G,U;q+Ɔ14<8oڽnr>Y#NG*j>b[+oWWYFŔ3- GlVvRy_/ 2/ZOl=|s W6J 4/TtfѰgz\cxT%;#*VI\C%u?rd]I״uqմ( <_J]0W(1fQF~ʱ Y^#m/*{Vo%Z m ׃ܶ -q?Ua?y t⥈>]ѡL8>ZyWHAtA8݈ 3|z{?f\EQ$ϴV#0WmmvJI@NK7Uםeuo:WkD×TtPiXRc] A{K4͉?4ˮm}otL~=cHkHJѫJijOEL@a螴1X˰+ku՗8dA8 ul8kqnYE {8(MWo]ڀI ODbYqgATŰ#}qMYrG[46nZm~ H5K.#OST݊r`m=Zd AR9jڑQyEx"!:ʋT-wu(G() !l`ή3hXN&*JJ%[  )(P!CPȆr'c%ucZ $122Vb|76M%7F@B"E $Jډ&s<~7w# .|p'KsSxtdiOx|qJYJdf$/k:-cVQND/ص' ݓPN7Z-uĆ- +r0$mt9DxOjb}ذژ^ZDяFN6sXol 6'!sn}4bn6h)Q'&syC̷ lX?J'?_ΗFQ c ki5 ԰'lEMog '< C$?pG3Ӗ'%/cIx=KC ][!Snej+&(2Qƣq> *;+8),[ P~`\jOo |I-}csI'h6tWGꮽiG\nt*Г] м]lvKlkk| y)߇t=lP*m2SGK97@9< Fhi!sr?] p/ksunlo<ڼC3>|XV 6w&ν01N9|Ч+Noٜ":U&ӛ;ΦIȘ.eWae>YZ>-YKM^%h4AZ%At5VQ;;M? ^*xy<^N-Qgؐ7׿+d("ojqXZVhy̹gq,օQBL),.PUdr|#Õ٬! 4+XUNW&Č\ذ}k̤VuuS\|{"'É-R%3P/I~fٖWev+TT ei[*x0Zv LN\Φi8)4JʐԷ~՛ԣ.O# IeS$DθeaI9+)tjt;r`2OZ|dg!^ц`SP37X 6QMDXBg:Ag|vy.|q/զ/iv ޙjK93Mpf#AcKT+'5Dž@~ןwy9kUUs'K5K4:C;o%Om4Ϭf~Rm2/n"HS,,V]zKW Ձإ UwtusD6ae[OxKUHMBЄJ4Š"ypz$ᤫvqUmʯIɡ_0u$lx%z|QTCg,Y4PN8d2_vۆ#kv ˮY{9=G^G2:FU'L*^w֐X^vn$fBf/IC}eZ/BpgUa+=IbBi.61ҝn~^أǀj)qڹbIi5!9^yG&E5;to?}LM endstream endobj 843 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 845 0 obj << /Length 5000 /Filter /FlateDecode >> stream HWr<)<|[޸,%~0 W3 %2Ig]s6Ws/cA9, S UWcW/vmo븮Wo=s1YwJozOU+__wɞ9? p%XGI֞yiD:է~ :ČMH^]קtEdZTbZ.썃, X|I̜1NSoe{jy?bw;\N<ˢh aa+Lm &-{+v|/UKv;>RM݋zMϋG<:[-j\OUumH_0OS+ZU/cSGyDEz #'#oQ a5 d:p#ǠWL?ռ~w\Oy[:7b٭/8ܘ;5Q\v~h{gLN*I:n1SCOS)#wV21R-Rgo< /~pV|tKKOjȤ&N=N\cm@@&^8OŴ,{eje_2' gOr9L͋V.9v(KzQpxq _T;~&ia^&Qǝz0n?Mp#qJ#X?MI֪Eѯj|hG!ZH 6t . cwrb%f#IlՁkux9(OýhW fAyY?IJGQ˟`}8a^pl-T?+۩r`!0޶x-HpKڝA!ehA; { ѻg!RhVR/Jօ~T-xՔ,X6-8ije38kEr( v/l!kJ$& [8[\ }IX^B̉8F78OoXLTݞß c{vqԁUaYϨ-^߳kmiFgYvY؆z4Mq/u/spTf=:?|,dĉlƠID"mh գֳƈVgazV ^"ٵ\aS̀҄]cBqvJ'1+3ۣ)F{Ux9MLk"S bO0"ũh/LS k;h$'I9gIG ݎ {pfIcRR x:1yxZ3ſ>̯;Y֭R9ӫ2 ݦeX8:5~хV%F[kYn'1(Ҫa J+G\QO tz(}J߽asY;[OBo͌ I`|&l$Iqq}&^Nҿ].L\%:!dDNg29ssapzYaйqO1 a2"jPN njE9 z k&+{S\(Mtp\ͅ>ǗW./0LJwg&WT (ꨑ=LB;g^]+QYzX NdsX8 ALλ_80 !%v$ f>@O:ڵ2o,/qI>& \qӇ6v+|y$/Cx]"0 &aԲH-/r9UM6e9 H:uΩ N (7u$^9V!x۹;P]B?3 =P޾`\'ĒāR%yPI0?7urH* }mHԫk((? +QhB;"}k- nɍPZ_)nwjC֥{cw4ך;O.]5Ey]pyf;y~՟`@ %O,в^ry[Ƕ6,ExQGs{"gr9 y)$^C?AV T^rpHu?^f d0?6Nk(/f\e`?{\`8^Bݮ$z4gs2d4^~ _4ʆ3*^MG 6Uj"X5'd^OuhwdIb\fgtWb_4ލޣa]pX]DZfb"WE཯ &ҥN$AuUH #~2is9Aj6 Wu3VEXwi0Cr' ؤ>̓p_Ue#?Dyq~.N(Jٹbd K߬LI]bj~> /ExtGState << /GS1 12 0 R >> >> endobj 848 0 obj << /Length 5103 /Filter /FlateDecode >> stream HWr<) Ö")č+ĸpqOl%3J^R~t>_Vq8[m.ROʼw\?HY9lU^7ξ^-gu\*oѫտ(q &Tg!r2YjR4F"k ( cvu=N'.ٿ~%zB'ybp_Bґ ԗ{Do_}O'1#I bRn=r#ǾHN߾}';}'vxzS'LÔ>v.(dE?N[v/}޵,cZ݁h%7tb 57r4>a7*G2ywг-nd7}eJ>o#oDnJuB:+עTȉ4bQ8QBPehZdZѶ(T5"cm@EU'kǺ:t(*tcP?<&p46>O}fWX,;JG_Tv= #Z?fv?@Z?W..=߉#Dxz`yD|5B}oY)+(1-ַBJ|GR (fC8vYvك`mh0QRNY'#u®ܴaSX%q:f 4*gb@::m=P-z.=w"NS)V7쾡b-}SID+E.72ϊTNM*P!MUK 1z~F?.OO*jV2w𡐪BOXPPsnD#!sU5(Nә\`ݫ<{z `(7=},(,QӴTA`Bn Q&wob Z`{N}C莾(XK1d3@1{ O3 -|Gn8te~ >Ց'BG+G4ؑ7S{a22{|GO`i;_lBgBrͼCZ]nJ 6#ӫ8Q Wd-yWƇS'csNLuf-ȠC>5:"F"?O[Ad sه\M%14Ÿdq+vztu {\j'4ᰟHJ#Fkby2$-Kæ$#@ߚ#ҴTtn.$zOM>L <1'~ɿ=,$!뚾Ԑa7R@WLq)6&BצWEel 9*;O6MeCsnd$K(ǂGkmޫZ>Slq?Nss-JIOJrZp*LU6oH^R*ǣk#f؋-6'S߆̆8tLO0"ňt6#F Bti S/4\Wd)}$0 M)a*2?[Ƙ5tNy0! bǓg'޲@, (0-;_Q_LHgL"Y!n\ 0IFI9+IVs h 7OP0!&UM`Yn:o_n` z:q ^8&fp>_>xvm|@^,4bJ?*}rEvPՍB1o\Jljq[#Ѿ\V<ŷXZHJ0EӴzmp ošGK>|Q{?hGYXH[:;v;ڕa-L8>GFk\w}Q|8 <'ȝLcJnu%y+jpz Nt9rT(U}nSavZ41rY#*P-z5%68k7pQݐf={JpXʤ)*Qi Nx:{=5mY ҉#j۬Qe&mN$j}1WXьȄk#=(g)+=~N.-%%:SSM}[n^ Ɯ:WV-tj |13%+ŴaZ3V~.kٻZ(Sg:rFψ.a~3x_P6g5-k,P +s S9[uk7%Y DVp(YKvc#g@GA}٣|-z_G]R',*\qJ#&7z~Qc%±KR ~Exg rѝy$3^wАa"l}8U.3uk\b| ?;fѽ/9w [z'E2v;3X|EӍhщ;\KQK&n9 8?ި߄ m2\R>N{w7瞞\w'JNF %4ŭx9|{jS[5lEe7*D Q+oaʳw;zNcC7̱/7O0rcxHs~GziʜKU\8lC\$9kfތ>^>-hKҌe -}i#:Xp`46.eNE"Pep:c*>mM\{$$mEkdETn)5JTR#` Otq@?"mu7udi endstream endobj 849 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F7 37 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 851 0 obj << /Length 5260 /Filter /FlateDecode >> stream HWђ}R$ @;)r,YΕb+%$0vqqҳ wJE3==7W> *e>l^KDKϏWW1`W Fj{:u&+jF֪D> %xmY+6^WɁ=9H0pjAbE-$fK99˅*Zֲe^zîEe.%5ez+.)nD^1P}|mg]#2==3tDY\kQ5i]Z&@rmOnRlg<5`ȑwh$SEG(^0(O%n9vP|%DKSgoz5۠7.hi7%oZCqYz{< +'a{Y{,4o F*@Inտ_/nadlhgK=v]3EZ!ݡj+wAjaנR(lLj 5NX)BxA,Q\c.mm)# {E-)8-H+ðQ./(ӹjqt- ujdQj_dYd yi][]dlsۘ%yDt6U՘^4F a*G$%KJ]dmb.Se AXƋad*6% sB/7A!H$`=WI|%;=L}6wq5 l'O۶@u`^Vg?E8LX3Y۳AЄ>t4HlHz®*< %L|Eԗj:BLr<9#-jTSa8[Eg;:V 82BujID3yv{XkHue%D4`N`Jd!ʈ*rYZ_wZcGG3E#F-i9^P9`F;]-UlbM6:k@-FBxQ,WƑ\ŵ6cZZWAhB'zar/n҂ լ(1K%Hv|`ôḪ%f\bÜkV鷭(O;<MpNKN;fY) ¹յ5?U( #T@TE'9خߗBU J=&ţô_m4rv{iY+n%H-Jp|)cS•XFV9kȏеKۺ"v#UDaCw8W?!˂п; g6Gcغp#$pGM)z9 ȟ[t,^G dWY*>9q1[M7.q.zn29YB|ӳ]/NH6C|@LF>a[Oq i9It(&%fj5oTӪ2^mzN/w݅bhf>da%W(J0&3fG꼝CANg:@a%lhS`ݓ0#޷20mZ’$:oTQԋdh0Pl~/p5pL_= :oԋ_ɮipǰq~9WU=GIq4B͹-[\jyw]V,us/ `І׷]~'=L(6h}&ٚ~dR\"zM۫jZ ldہ?KeFpwXq_C/ 峯}G>NfTޭg[Y~ QrlXBv >L҃:O< Zd-v+x] z#Z,GL=8b1MEr*;3JɮW#yNGݶ؂ t~~)7얀tB_٬El1Sv-6ۍ7s;v1{B^&!䨍n'vmϨ{aLY>g!;O^|/TV%gחs"?_ԣ-dd?IY/ݴ!OetJ+Vlwoj6߷ w.DES'3}Q ˆxcYZdftn^;Fw7n?d0ưE3}WR@8g-7r>9agCt/ذ|˃ {H..TȦtK(At|M9;k\ R~J咷[gԢy wå`2Yf4"6kT-eSv ps~Q→J6#udP܉ժ|ﰛ^ rcŠ[r&Ym`m`ZF"A @f~TMͳfb-g~{zB8 ']Y8%kYk3(XeH=ϳ GDr|/'.1 0]7"c=WʅN$#3IiHNz iEɛTɩL~ZEƽ]YI8Fi;ʾ$m`5CGg'wyCWVי:*sZfڷmjPd:94%8e Z!!s{pZVJ؞ xdgixR+_yCa)  ,{)ōMKP%5lFv2^\tD1p6?Ǒ  I<X^[bkV.pT06 lłB-e3Sk:{[C3{AAj(yib쏙 j_3JͰmp FYjU-vh ' 3  ԎڃnNpJ,+C[F< ;eËJׇFhL$GwjҌ4/pAsf'7LnXYZ8[4~PFivCHjxЮaʄ8$*?Ko 8vDn 5[ւ?r?һȈGGx5<^lHw`Qs?9Se  I֏* MI!UYQ,08mPY],N*nJC e9}QzW&6;ժoW$H&D~29Dp#?} {XT uR;7gP;mQa>CZ<UH G&L!Kz0c  ex1Ղ۾m/Kht2z6ds*eش*a0[.ck=1= %R56Ul6?|M'/jb&T. m~uuz蔿$r Y%/F M;|yОvn\ zӒk` uwAϻ/_ endstream endobj 852 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F4 5 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 854 0 obj << /Length 5120 /Filter /FlateDecode >> stream HWے۸<ʉ&)^J|ɦJa' II!lr )RsaT>}ləE KaĶo כ7|߰f{jO2;i{ۏ7+Aխ*/FFeN Se_xStZtڙL $bGIFoCݪlZa~i.5s&Bg"8\P ߋ<7wfY-xd8;3"=3#c*u8A5͐\F=|gykQ2ؑSzY۟ ,Bb/$<^žAk_U^4GfooWIO)AǣyĞ2`E'2͎0UI-$^Ǽ+^ ,Ll4s5ueH_c#4<vnS{6fE'w(Iv8J2 |iv <bygdQ w(Qz0Dث}xU-NpFr%PZ{ѝ-c([\lU9;TDZ om:Ǿ`@7.H\~\Sh"o_w)gv6NF$ uϵ{G iAMޥe,u34^PˍB"PQ[aXfNm%8ܙcn:[Q=QQu^O = ̔AD_lܽpر40KH^jo뷌#`Ƣz+8m$eA퀁GHiB}•ODHڒ7 9(=X33PU9abz􈞳k)K8AD2q>wRgfR2!}Oc\bĨ- z^X+m6zx$(.9C.&!T"0t # 9H_T|$'?!c|@`ٺBcVAf3|׊4aC+34ZkP4A]#⦟dYOr_8TCJƢ˄ A;Ѳ?wEm Bu=L+ v"*zI? 6_0zϝ>3t9xzeyaSV}Q]^gekF,[d}UVвi|懧ɓt,.*U NӄyxܛsWϮفx2t胏ǵjzr2QI"]Pe4ԁw;~KcC^ .y@A4Y:h!-X\tDRIc*1JzbN] t/ >I Y^`fБY8}ƱӑQ'j{4I4 /QIK{Z15-Ƞ5jR q{.:! BdDAiHodSZ 4-->o{31\bGZ+Uk/eaGJ= J%'9m[$1ϣN|/#]}S"wf= "r8mPI޶%E6Cv'֨[f4nKVb^@d!ϥDjfʏR׮!14TA5cgEێ5c9aU{Wɇd嚟Ӧⅰ4Ql.ˠB^h}JcvFh!^DQkxwx6AE6GHMJ~fj^5Ջ=MuuשsaJ!c egc,|_ ;Qhs%-$Zf&qN~*)㏢{W[M S|c`ؖ/ : H }#JmHtf@nK lCA9vX"*"ѝHeshΈfo} Q실AaN@&AܯZsRll v$30}x,vS{ mx.O.Qw{/ FAt/w38Iv=*;Xx:U3X.z΄Y`p sLJmEB7Xo+*xZZ- lGc#>#{poF)3vޢ:T;]X6<& @|?3V'l9%2m^\bf._V1#ŔZ -rxHCj ėT6 bݶ.' $YMG N1Dz3ueOܑ= X5 59J_*IJ&@l#[wy(™on3wxt傇F3 9wn_j"_v3;=[Ya'1l]Wn;RlH:Rim3d0"eK~q&_fz_::?Á[nOXx\)"aY@쮢`XdӰ$( ES>r iApU!㲥"Z&=e4p# J19̰7kzMޜoX`XzR Y И. $p~"ol[*ͭ[  t,NLmNJ3R IfC]󶦼ݓeʙWVuPj!TSu \jWe"Xbg5ӾGǤI)cI2iuDF]QFӿk%+,HC"J<SUݴn.t>ܲQ`zF' h$Ӟ:M5vfL0ȨD-NѻhKM'6UFd3~1)/]S+'U_h~[dΆ}BcGSvhDSϯq}iZ^*5/䉫B VKQ!v%8RxRᵭt@2:.ՙ*/HNh'#sXw0}GW_\(&uWq&~]ߵtcN:m.,)ic/SoX97JBA|yk]9oiXo_o7^ު 5s 50Èة'&%+ anV\S'6[[/xr <׵=ár rAOEøSJXTgyHb)`h+΅MY'doK1<0%G B:), I, ј:ߖFiPT~u@ E{\ї,8Usf9U8ÚSРp.)]pfUr }7+Xao<BК8&a^c%ACL-dX0PSCFZ3])v=^ݤZLDƟɦ(ֵِvNϥf$_ZKtuaWOJIL/dzqtNNږϮP 0'7CO`gGHj endstream endobj 855 0 obj << /ProcSet [/PDF /Text ] /Font << /F2 29 0 R /F6 36 0 R /F8 44 0 R /F10 72 0 R /F11 79 0 R >> /ExtGState << /GS1 12 0 R >> >> endobj 857 0 obj << /Length 2830 /Filter /FlateDecode >> stream HWn8} ,lUXtgE3-v< %F=ożϞKJ"?={f}3۫Xp/~ʒ00l]]K^ gǫM(\L{S}*{vlJ|]E'sw2< XZbgnA_E܋$fcZF''QlOn/ vThu{J]+fj&N?NU^v^zhk*u|}qP/ΰB\G5}vPMꎙUQlTIgmbg }/ыxT;\ +D,CCwOXtN5mXD[?[T_8^6Eyy(,K[kPJƖu=;D 2~qM V>Z-kSEUdr{SuAA4?T%uy`7+;;걟=K=dǺ%=Bj nԶ;4 x/p/'qū jzN~ߡQUV01WIh9(ER'_tmtk fTp`X^dW砲l j} -#q +g~Qqʥ1`9q}m'\'PJ=h,hŦ?#G.Áofq}{" oI@] ^,ꁗu'KB7As,ԱIJP,nL#-2iT睤jUn3\aWEsBpF3u^NCmv .ٶojZ"u$`Z0urT9LCRvh"q*R4H*igJ>Pʾ. y/˘Eyѕ(0UK".ٺdT-7}*jxE4g<֕A<0tT赗@z% x>(MBl!mt(%U$X6s/F-P:S(y:(҃ʅtD3+##J1}ch5h m-u0\_;8)@ \µ0yln[S}6 є½YcfU?pQ`0`D<.!ۚZCO yVbk*``78p(;EZz(4PA<{ Qaڨ x^ـVDJ}jBĀ'ttCgZ܃64u#J׀q+[佚 KĊ6XAn6y;rbe'ӎmUa)J' }?8ӉF*e$Uoi刞r-M[r`6TBoۜJ3K`;c~+8t9[ OLb_\ XgSEd:. q\ؑU[ʕ!CU ![N"AF/{<,Zrss> |`I<$͛g|FFw[>Ma- &C}v歩gR'@v}s 97_.K20G_ƳRЋ#85ɂspp=Cglm3&DeiY"ʍںZx)UenYc>@-K.v857]T O.+^^JBt{NQ@ftr\<+NoZ (k:Pd)]KJb?EhG5,dΡ-?W{21Gq8}u-b-<\[QT"AjfrnpG{ |gcoo;(fm[ȞA9?XxGo$P3AXhR^iw^Kdkqƹ}Yssbuj݅,@<蜻_Sk)1B,Ԣ±$24j̓ 7}/l\0ޘl |k/xvPP8;Nϋ:kHHE< 4v$ EM%jخb(,4oVQ|t#.b[lPĿwvwdfr2sVM\О7mB!`m(s„'4!?F05qCdk־.]Uv +WF)HK 9?Õp/xlM 6|fwT ],"'U6 e` %GЦ6gRJHJw>۴*{)x_kF ,xZS]I> /ExtGState << /GS1 12 0 R >> >> endobj 861 0 obj << /Length 4950 /Filter /FlateDecode >> stream HWے۸<)E"'W[u*C$dH(_J*H%rݍ>OpmJO6eM]ݷw{W?}L7]q݋4٫FqZǻn;4RٟE{=βB(zz˸C+!sqGIZlD&Q`*!+\ '3Δ8bf7Zrua<g^6¥nG8N):I^FtQ!gw ;dՉnYm?/:)P&?I@u/d\6+ );hoFc'1EȶӦLE!slA\bkCm6xFN%p˨|Kmi~{+Z'y<5BjvTED:6w˽k(zMOtZC*IpMjaa5LMb<C>xC_L'F(8C4"|RxMK냠ɮH(BZ QZo,&L=:+zXgXbJ'iJ칅:Il4Zg\k$e]l82H"s)=M0U9dVğ0T!Z'hc+KeffiA̦-} TCfzgqa҉K7J&ZMתftIӝ4Z`OL : < D$?rb?JrtG.8K5s#E+:l<5Q,B-:pV*F±{-Ěӽ|vlDLzr>ׄVcة]Fim]//c%=y3,J"|̰7ŨԮ^' +v4't 7y҃cI4"+8 ~#%hqr,,j-gCs`J( 9}jLeRgC7f!ϓ|x)z)l{9?hp]zxBœ*` O/,Ki/BvcIJN!S? u*[_5v]%%(ԼpjMv`n Ae F;4l\֋գn0YwX[uG7ڎ'Jpۯ)*Pf'_+(|./ ,GEu#˗t)\kqknX*T-@РFfu>xǩ(Ȱ`N!-`&ʏ2J@(5TXKF+>߂E9>XLϪ2u|{b#gqo4b.r tC(4,8sK 4 T' $;҈ 0hD\/QB LFeFrwK%6-`uHx:eWcyc5 _&8F<`qjf]F4igЦ?|?Bǭ3f8 Hy{O)^$wWax{[/;S(1zh!ƾ;D?Kӊ`*pur,D[ mt;PR3=i\bo! ieev8.|A=証*,,.?oKs.lny}ŧP.Ppx9Y+Fgi N6P*$ׇxj[$c-K׋h7w_6nk1<}7WJۿN kK/][U6?U<3BD pպx(YLHg~RZ͖@I̚bG0|յjiL) k{zͳNuQ,hӓ(\@]"WfW+Yf1|jAm.mS?+]ӠS;U9 B)hgmTabAs]O/4޸G2O7_*nʐn ^q_YW+1Oӥ jPc9xۤQoKY# ZA Lڜ6P,%ʅ k6ﷰ^AD.HKSkK٪[1yYyfsF]_mĸ4h4u[eQW_a Gʩ*ѻA!\g:)uݢż=W 栩mN_m n~`Xuݔl fcN2zqpdMRۼ׈]VNE8DJˏn]۸:O2\Z+aFː8'ZUx0ה)դhȖ2հd_WŐ2D.e($etl0R͓(6bǯlŲmH[encR^{,\V7b4ãﻜ9]{}잸(W9a{I %:8up/] "њ̨k2 ; :]x+sЬ%inY ` "XiDB 6Oeb}VlٯnGuoN jMX%]!ثtv-vȐP̟nʜ<N>"!!ޒAu#Uֶ ˮ]!Ko2ʎQ:]qƚ=hMb\kHSJ[U! d[> /ExtGState << /GS1 12 0 R >> >> endobj 864 0 obj << /Length 4168 /Filter /FlateDecode >> stream HWۖ!!`